Standard Jet DBnb` Ugr@?~1y0̝cßFNf7ٜ(A+` {6߱%iC23fy[(|*| ~ -f_Љ$g'DeFx -bT4.0o*< Y%A@S %% Y   Y VY  Y Y  Y  NY  Y  P Y  Y  Y  Y  Y 2Y  Y   Y  Y ConnectDatabaseDateCreateDateUpdate FlagsForeignNameIdLvLvExtraLvModule LvPropName OwnerParentIdRmtInfoLongRmtInfoShortTypeYYIdParentIdName        OYyCP3S  $Y Y Y  Y 2ACMFInheritableObjectIdSIDHP3 YObjectId YS  Y  Y _Y Y  Y , Y hY  Y ,AttributeExpressionFlagLvExtra Name1 Name2ObjectId Order,h,h ,hY"ObjectIdAttribute   -YS  Y Y Y  Y  Y  Y  Y  Y ccolumn grbiticolumnszColumnszObject$szReferencedColumn$szReferencedObjectszRelationship   YYYszObject$szReferencedObjectszRelationship v1b N  : k & 1+0IP  @@ @ @@@  JO`YbOJmJJMMQkkfJUQkOJmJLJkQkSdi`k `dOo^Qk iQ^JmYdbkWYfkiQfdimk kMiYfmk kvkiQ^ mJL^QkJJdLkQiqJmYdbkJJkfQMYQkOQkMiYfmdbdSSYQ^OkUQd^dUvM^JkkQk[oiYkOYMmYdbk^dMJmYdbk`kvkJMMQkkdL[QMmk`kvkJMMQkku`^`kvkJMQk`kvkY`QuMd^o`bk`kvkY`QukfQMk`kvkbJqfJbQUidofMJmQUdiYQk`kvkbJqfJbQUidofk`kvkbJqfJbQUidofmddL[QMmk`kvkbJqfJbQdL[QMmYOk`kvkdL[QMmk`kvkhoQiYQk`kvkiQ^JmYdbkWYfkf^dmkf^dmkkfQMYQkfid[QMm`QmJOJmJ kfQMYQk^Ykm!JMMQkk^Jvdom`kvkOL+ 6QJLDMMHOMJ8>OOBLJ@>SDSL@QFL+ +;K["[oiYkOYMmYdbk^dMJmYdbk#f^dmkf^dmkkfQMYQk/$  @ @ @ @      " # $ % !v1((  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @))))))))) ) ) ) )))))))))))))$)%)&2!2"2# 2$ 2% 2& 2' 2( 2)22 2 2 2 )@)A)B2 2222222)')()))*)+),)-).)/)0)1)2)3)4)5)6)7)8)9):);)<)=)>)?)C)D)E)F)G)H)I)J)K)L)M)N22222 2 2 2222%2%2%2222222 )))) )) ))))!)")#v1 v1@88 @+ 6QJLDMMHOMJ8>OOBLJ@>SDSL@QFL+ +;K[;[oiYkOYMmYdbk^dMJmYdbk;f^dmkf^dmkkfQMYQk/; JJkfQMYQk;^dMJmYdbk;f^dmkkfQMYQk; @@JJdLkQiqJmYdbk;[oiYkOYMmYdbk;f^dmk;%d _ Z g  ! O $*t os@J Y*}@Y*}@PlotsPlots-Species}FFFFFFFFFFD  epD@epD@JurisdictionsLocations}NNNNNNNNNNL nք@nք@{0EAB7CC9-DCA1-4DD6-BA54-F7FB5E8B3BA4}}nnnnnnnnnnl g@Ҋ㎪@Species List}@:FFF:::::::8 @P3@@ s@Project Metadata} @6NNNBBBBBBB@ @%/ @[>s@Plots-Species}.cn HHH<<<<<<<: @`/E@s@Plots}BTm 888,,,,,,,* @ (@(@ MSysNavPaneObjectIDs}4MR2KeepLocal  TJJJJJJJH @gѱ(@gѱ(@ MSysNavPaneGroupToObjects}4MR2KeepLocal  TTTTTTTTR @D(@D(@ MSysNavPaneGroups}4MR2KeepLocal  TDDDDDDDB @ذ(@!U(@ MSysNavPaneGroupCategories}4MR2KeepLocal  TVVVVVVVT @!-E@I^A@MSysIMEXSpecs}<<<<<<<<<<: !-E@I^A@MSysIMEXColumns}@@@@@@@@@@> KNq@KNq@MSysAccessXML}4MR2KeepLocal  T|||<<<<<<<: @A@A@MSysAccessObjects}DDDDDDDDDDB M@͸s@Locations}@3@@@44444442 @uY@ຑs@Jurisdictions} @:HHH<<<<<<<: @ |$N@S s@Geology Classes}T@LLL@@@@@@@> @rA@ s@Descripton of Fields}7@ SVVVJJJJJJJH @B{ ք@+bs@AA-Species}@SBBB66666664 @Eք@![s@AA Observations}q;N'f LLL@@@@@@@> @ QcD@p@Admin}$ @8,,,,,,,,,*  cA@Xni@AccessLayout}4MR2KeepLocal T"@*zz:::::::8 @G,E@G,E@SysRel}.........., G,E@G,E@Scripts}0000000000. G,E@G,E@Reports}0000000000. G,E@G,E@Modules}0000000000.  F,E@ F,E@Forms},,,,,,,,,,* ^A@^A@DataAccessPages}@@@@@@@@@@> MSysRelationshipsDDDDDDDDDDB MSysQueries88888888886 MSysACEs22222222220 MSysObjects88888888886 q@MSysDb}&@,::::......., @Relationships<<<<<<<<<<: Databases44444444442 Tables.........., <Y polNaEa 0/r Y ( Y x Y ( Y ( Y  Y  Y  Y  Y  Y , Y  Y  Y ( Y  Y  Y  Y (Y  Y d Y Y Y  Y Y  Y  Y ( Y P Y  Y  Y  Y Y ! Y  Y!! ) Y""  Y## 2 Y$$  Y%%  Y&&  Y' ' ( Y(!( d Y)")  Y*#*  Y+$+ d Y,%, @ Y-&-  Y.'.  Y/(/ Y0)0 +Y1)1 ,Y2)2 -Y3)3 .Y4)4 /Y5)5 0Y6)6 1Y7)7 2Y8)8 3 Y9)9 d Y:*: d Y;+; 2 Y<,< , Y=-= Y>.> 4 Y?.? Y@/@ 5 YA/A YB0B 6 YC0C YD1D 7 YE1E YF2F 8 YG2G YH3H 9 YI3I YJ4J : YK4K YL5L ; YM5M YN6N < YO6O YP7P = YQ7Q d YR8R d YS9S  YT:T  YU;U  YV<V YW=W > YX=X YY>Y F YZ>Z  Y[?[ d Y\@\ d Y]A] d Y^B^ d Y_C_  Y`D` 2AA Obs Code County Air Photo NumberPolygon CodePolygon Size,Primary Community Name0Secondary Community Name2Classified Community NameNVC ELCODEJClassified Community Name - Secondary,NVC ELCODE - SecondaryEONum SuffixLocation CodeSublocationSublocation2Quad NameQuad CodeCoord SystemGPS FileGPS TechniquesField UTM XField UTM YCorrected UTM XCorrected UTM YUTM ZoneGPS DatumGPS AccuracyField LatField LongCorrected LatCorrected LongSurvey DateSurveyorsElevationElevation Units SlopePrecise Slope AspectPrecise AspectTopo PositionLandform"Surficial GeologyCowardin SystemHydro Regime"Salinity/Halinity$Hydrology Evidence,Environmental Comments$Landscape Comments% Bedrock% Large Rocks% Small Rocks % Sand% Litter, Duff %v1b N  : k & W  C t/8@? D! A@ A @ @@  m|z||  a;%AmSA x YX@ ( (F(2FYl@APIS.AA004AshlandxBetula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]Betula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]CEGL005245APISOuter Island15NAD838.7mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUpland@/plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mL@.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:50xqoooig`"~~xlg[VPP888882+'''''' aaa_VJE12E?a$ASA x Y X@ ( .P( Y2l@APIS.AA003AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISManitou Island15NAD838.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandSome blowdown/uprooted treesplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@.t@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak68:30 AMCEGL002457x422&yyqjH;;  A5aaa_VJE72Ea$ASA x YZ@ P.F( Yl@APIS.AA002AshlandxPinus strobus - Populus tremuloides / Corylus cornuta ForestPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APISStockton Island15NAD838.5mJ. MarrFlatn/aFlat (n/a)n/aHigh levelflatUpland[none]plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mX@.@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus62:00 PMx_]]]TRI }pp\\\\TTNB=1,&&      aaa_VJE12E0?a#ASA x YV@ F.2 (Yk@APIS.AA001BayfieldPopulus tremuloides - Betula papyrifera - (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach115NAD8310.9mJ. Marr, B. Dunlap, C. Groebner1Gentle2 degreesVariableHigh slopeflatUplandR@/plant stemsCold-deciduousBroad-leavedForest15 - 20 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@. @-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:02 PMx}v83''xmecBBBBB;400....````VJE16E?! 7a2%ASA x Y@]@  P.(Pd @APIS.AA008AshlandChamaedaphne calyculata/Carex oligosperma/Sphagnum spp. Poor Fen Dwarf-ShrublandCEGL002471 - Larix laricina / Alnus incana ForestChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Larix laricina / Alnus incana ForestCEGL002471APISMichigan Island15NAD835.4mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@/plant stemsMixed evergreen - cold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:35xui^^SE#   ~xxlF:____VJE72M?a$A@SA x Y`\@ (( .(l@ APIS.AA007AshlandxAmmophila breviligulataAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISStockton Island - Quarry Bay15NAD835.5mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopebeachUpland*@/plant stemsPerennialGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10612:22Mixed conifer-deciduousx:88 ~sffZZZZRRKA<0+%% zzaaa_VJE12E<ab$A SA x YY@ d.(P<dl@ APIS.AA006AshlandxChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISRocky Island15NAD834.5mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLowslopeflatPalustrineSaturated@/plant stemsEvergreenBroad-leavedDwarf shrubland 2 - 5 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:50CEGL002463zzznhf_!vvpfaUPJJ22222,%!!!!!!aaa_VJE12MaZ$ASA x Y W@  PPPk@APIS.AA005BayfieldPicea mariana - (Larix laricina)/Ledum groenlandicum/Sphagnum spp. ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APIS Sand Island515NAD839.0mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturated`@/40% plants stems, 40% sphagnumEvergreenNeedle-leavedWoodland20 - 35 m15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 mP@.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak711:56 AMxYTTTHHHHHH>4)yyoe][888882+''%%%% ````VJE16M?L X ba+%ASA x YX@ 2 .(Y< @ APIS.AA012Ashlandxwet meadow mixed herbaceous mapclassCEGL005174 - Calamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174APISOuter Island15NAD8311.5mJ. Marr, B. DunlapGentle1 degreeVariableBasin floorbeaver pondPalustrineSemipermanently flooded@ /plant stemsPerennialGraminodHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@.@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:39xxxllllllbXXMBBBB+!  ||||||b\\P aaa_VJE72Mx?apn$AƿSA x Y ^@ P.((< @APIS.AA011AshlandxPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002077 - Quercus ellipsoidalis - (Quercus macrocarpa) ForestPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479Quercus ellipsoidalis - (Quercus macrocarpa) ForestCEGL002077APIS Long Island15NAD837.9mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandQ@/plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:15cedar, oak, maplexuuuuuuukaVK?44,%rll`+aaa_VJE72Eah$AkSA x Y_@ <.Z<2YFl@APIS.AA010AshlandxAcer saccharum - Tilia americana / Ostrya virginiana / Lonicera canadensis ForestAcer saccharum - Tilia americana / Ostrya virginiana / Lonicera canadensis ForestCEGL002458APIS Oak Island15NAD835.7mC. Groebner, N. MurphyModerate12 degreesNEMidslopehillslopeUplanda@/plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mSugar maple with basswoodLeaves eaten in canopymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:50xVQ--~ttpdZZBBBBB<5111111aaa_VJE12E?azA%A@WSA x YX@  F.(( Y<l@APIS.AA009Ashlandxwet meadow mixed herbaceous mapclassCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestMixed Herbaceous Wet Meadow (map class)HWMAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island15NAD839.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@/plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m <0.5 m@.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:25CEGL005044xpkkk_______UUUJJ>>' lffZ aaa_VJE72M) s 'a#AjSA x Yc@ .F(Y   APIS.AA016BayfieldxThuja occidentalis - Betula alleghaniensis ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island15NAD836.2mJ. Marr, M. SmithVariableMidslopeflatL@ /plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ .:@-Opt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCannon PowerShot71:35xmmaaUUUUUUKAA6+  tnnb&bbb`VJE72AP>a%AwSA x Y^@ 2.F2Yl@APIS.AA015AshlandxTsuga canadensis - Betula alleghaniensis Saturated ForestTsuga canadensis - Betula alleghaniensis Saturated ForestCEGL005003APISStockton Island15NAD834.3mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrineIntermittently flooded_@ /plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@ .mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1065:12xOMMMGE;}}qqqYMMG=8,'!! aaa_VJE12M0?a <%ASA x YX@ FP<Y @APIS.AA014AshlandxThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISOuter Island15NAD838.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drained, some blowdownsplant stemsEvergreenNeedle-leavedForest20 - 35 m15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ .c@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:15x ynfWL??  NBaaa_VJE72E0?a%A@`SA x Y@]@  2.( Zk@APIS.AA013AshlandAmmophila brevilgulata-(Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISMichigan Island15NAD832.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatUpland@ /plant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:20maplex<::3-+$zzthcWRLJ22222,%!!!!!!____VJE12E  ate$A@1SA x Y ^@ F. (l@ APIS.AA020AshlandxJuniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandCEGL004024 - Hudsonia tomentosa Dune Dwarf-shrubland [Provisional]Juniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandCEGL005064Hudsonia tomentosa Dune Dwarf-shrubland [Provisional]CEGL004024APIS Long Island15NAD833.7mJ. Marr, K. HiserGentle1 degreeNdune*@/plant stemsEvergreenNeedle-leavedDwarf shrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1051:19xyodYMMM<-"      i]aaa_VJE729A8?ad$A@SA x Y^@ <. (Z2Y @ APIS.AA019BayfieldxAlnus incana Swamp ShrublandCEGL005277 - Chamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandAlnus incana Swamp ShrublandCEGL002381Chamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277APISRaspberry Island15NAD839.1mC. Groebner, N. MurphyGentle4 degreesNLow slopebankPalustrinei@/plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:04xwrrrffffff\RRG<<00%uooc bbb`VJE72Ey?a$ASA x YW@ P .<2Y APIS.AA018AshlandxQuercus rubra - Acer saccharum ForestQuercus rubra - Acer saccharum ForestCEGL002461APISBasswood Island15NAD839.1mC. Groebner, N. Murphy, B. DunlapGentle2 degreesVariableHigh slopeflat!Mesic woods, lake 200m to east.plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 ml@ .@-Opt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:21 PMxA???64-{nnAAAAAA;//%aaa_VJE12AP>a00%A6SA x Y[@ P.( Y @ APIS.AA017Ashlandwet meadow mixed herbaceous mapclassCEGL002282? - Potamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMPotamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationCEGL002282APISOuter Island15NAD834.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLowslopebeaver pondPalustrineSaturated@ /plant stemsPerennial herbMixedHerbaceous vegetation <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak712:00xB==========3333333{wwwwww]WWK____VJE72M?2LVALN2x f 2 $ 8z,dConfusing type (in polygon?); conifers >25% relative cover; deciduous about 20% relative cover; lots of Sphagnum so keyed out to CEGL002456; description doesn't include Betula alleghaniensis but it's present in APIS description.Beaver disturbance community; no clear dominant.more Betula papyrifera in canopy but if Thuja is dominant due to dense subcanopy, then paper birch with cedar subcanopyMixed deciduous / white pine forest; >25% relative cover of hardwoods (Betula papyrifera) in canopy so keys to CEGL002479; if overestimated deciduous cover then keys to CEGL002445.Tamarack (black spruce) "woodland" with dense cover of Chamaedaphne; fits CEGL005277 best but could be sparsely canopied CEGL005271.Mostly hemlock and cedar with some red maple. Very little birch. With red maple could put it in association CEGL005044.Mostly alder with leatherleaf understory shrubs.Appears to be shrub-dominated type (primary name). Some areas more forb/graminoid dominated (secondary name). What shrub type? CEGL002381 without the Alnus? Need a Myrica type? Difficult polygon.Best fit with Fraxinus nigra dominant in canopy. Carex spp. Present but no perigynia to ID correctly.Easy to key. Polygon to east is Chamaedaphne and Alnus (<2 m) and some Myrica.Bigtooth aspen in canopy with yellow and paper birch subcanopy.Sugar maple with about 30% hemlock.Deciduous forest; keys to CEGL002457.A few emergent-type Picea mariana; lots of Ledum - more like a Ledum shrubland with some tress (not in key); vegetation description reflects shrub choice.Vegetation >10%; no other choice for AA community. It appeared more shrubs than open sand but only choice for eroding slope on shoreline.Not enough deciduous except around margin, could put in CEGL005044 if boundary lines overlap.Keys to CEGL005064 or CEGL004024 (dune dwarf-shrubland; neither Juniperus communis nor Hudsonia seemed to be dominant so put both types down).This is not a bog situation, just alder with very little bryophytes. Dry along shoreline.t + aN&%ASA x Y[@ F.((YFF @ APIS.AA025Ashlandwet meadow mixed herbaceous mapclassCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandMixed Herbaceous Wet Meadow (map class)HWMChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISOuter Island15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@/plant stemsPerennial herbGraminoidHerbaceous vegetation 1 - 2 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:10black spruceand paper birchxidddddddddZPPE::::#f``T ____VJE72Mxax%%A@5SA x Y ]@  <. 22       ooooggaUPD?99!!!!!aaa_VJE12E?a~$AZSA x Y\@ < .86/xl````XXRFFD91/ ____VJE12Űa %A@SA x Y^@ <.<(2Y l@APIS.AA026AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD836.6mK. HiserFlatn/aFlat (n/a)n/aHigh slopeflatUplandG@/plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mEasy to key, fits well.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:25xa___YWM   ~qqeeee]]WKF:5//%%%%%aaa_VJE12E0?LVAL'm { '  x ^ I  h{"Ya>Fto west of polygon is steep clay bank with scatteredto west of polygon is steep clay bank with scattered shrubs of aspen and paper birch and grasses (sparse)Calamagrostis-dominated community adjacent to the southpaper birch with balsam fir to the south out of polygonstanding water in channels SE of damabout 20m SW of point is a wetland opening (5x10m) with Glyceria canadensis and Acorus calamushemlock stand to north of polygonPhalaris arundinacea patch about 10m from AA pointchannel to west has floating-leaved aquatic (Nuphar variegata, Sparganium) and submerged species (Myriophyllum, Utricularia vulgare)adjacent to hemlock, red maple, yellow birch and paper birchto north Thuja and Alnus become dominantjust SE of AA point is pond edge of leatherleaf, peatmoss, Iris, Carex utriculataadjacent to sugar maple and paper birchadjacent to paper birch and maplestream to the west of polygon; south end of polygon is cedar stand looking north to ashTombolo Ttrail to NW of point; narrow swale opening at 686550, 5200419 dominated by Myrica, leatherleaf, sphagnum and Ledumabout 12m north of point is moist depression (black ash forest with Euthamia graminifolia, Juncus, Carex spp.)about a 20x20m mucky pool with sphagnum and Calamagrostis SE of point; black ash trees in drainage 40m SE of pointhemlock stand just to each of polygonadjacent area with paper birch and maple with some hemlock and cedarlarge polygon to north mostly dominated by sphagnum and ericaceous shrubsarea north of point is wetter with areas of standing water; beach community NE of polygonto NE and SE are dune hills dominated by Ammophila; immediately west is inlet (drying up) with Brasenia schreberi and possible Eleocharis robbinsiiadjacent area paper birch and maplejust east and west of point is NE/SW-running ravine; north is narrow polygon with dense shrub layer (Acer spicatum, Rubus parviflorus, Corylus) and Betula papyrifera dominant treenarrow strip of land with shore on north; alder thicket on south; open pocket between trees looks like an old 2-track road at one time; mostly black raspberry and grassesto west next to Populus grandidentata which is losing its foliage; also next to sugar maple and yellow birchnext to white and red pine to eastlake 10m to west; north of stand is steep ravine with flowing waternext to paper birch - sugar mapleopening about 30m NNW of AA pointforest on north edge of polygon is mixed deciduous/conifer with Tsuga, paper birchnext to cedar and hardwoods and birchemergent white pine about 30m SW of AA pointabout 50m south of point ledges end and replaced by large boulders that form shoreline (even less vegetation); about 20x20m shallow bedrock pool near pointhemlock on western edge of polygon (in or out?)next to hemlock, maple, birch, oaknorth of point along shore are sandstone ledge and Ammophila beachthin strip of forest at top edge of beach (Pinus strobus and Pinus resinosa primarily with red maple, 10-15m tall); wetland strip behind forest band with leatherleaf, sphagnum, Pogonia, etc.next to paper birch and cedar or clay bank habitat south: I #Ra %ASA x Y@]@ F.(P7333333____VJE12M?<n Ta$A@USA x Y@]@ ( 2.P<Y< g@APIS.AA048AshlandTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISMichigan Island00215NAD838.1mC. Groebner, N. MurphyFlatFlat (n/a)High levelUpland well-drained, minimal blowdownplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:15x#!!!]PP$$$$______VJE16D?a#ASA x Yc@ -2.2(Y <l@APIS.AA047BayfieldxThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456APIS Sand Island15NAD8310.9mJ. Marr, M. SmithVariableLowslopedrainagePalustrineY@plant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon73:00Active beavers in SW polygonxmkkMGE>tttthh^TTJJJJ777770)%%%%%% bbb`VJE12E0ad$A@SA x Y@c@ F.F YPPl@APIS.AA046BayfieldxAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APIS Sand Island15NAD8311.4mJ. Marr, M. SmithFlatn/aFlat (n/a)n/aLow leveldepressionPalustrineSeasonally flooded@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m <0.5 m <0.5 mn/amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCybershot74:55x xjZMMAAA-!! bbb`VJE12M0?a$ASA x Y`\@ d.( Yl@APIS.AA045Ashlandxwet meadow mixed herbaceous mapclassCEGL002562 - Nymphaea odorata - Nuphar lutea (ssp. pumila, ssp. variegata) Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMNymphaea odorata - Nuphar lutea (ssp. pumila, ssp. variegata) Herbaceous VegetationCEGL002562APISStockton Island - Quarry Bay15NAD838.0mJ. Marr, K. HiserFlatn/aFlat (n/a)n/abeaver pondPalustrinePermanently flooded@plant stemsPerennialBroad leaf herbaceousSparse vegetation`@@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1066:36Upland forest (flooded edge)- A. rubrum, B. papyrix|ppddddddddddddddQ:/""~xxlaaa_VJE72yM@ah+%A0SA x Y ]@ F.<( FY<k@APIS.AA044AshlandBetula papyrifera/Diervilla lonicera-(Abies balsamea) ForestCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISMichigan Island15NAD833.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatUplandK@next to cedar standplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:45xxmbWWOA1$yssg+____VJE72Ő? m 2a$A@DSA x Y\@ 22.P(Y< l@APIS.AA052AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD837.9mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandModerately well-drainedplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mF@#}@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:00hemlock, birch, maple, cedarxzxq3."" sssskkeYTHC==%%%%%aaa_VJE12Ea$$ASA x Y\@ (2.(YZl@APIS.AA051AshlandxCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISStockton Island15NAD834.9mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrinePoorly drainedplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 m@#j@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak66:00Birch, maplexC>22&&&&&&xsmmUUUUUOHDDDDDD'!!!!aaa_VJE12Exa$ASA x YZ@ F.F(F2 @APIS.AA050AshlandPinus resinosa/Vaccinium spp. ForestCEGL002520 - Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestPinus resinosa / Vaccinium spp. ForestCEGL002443Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestCEGL002520APISStockton Island15NAD832.4mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUplande@ plant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@#mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:00bogxwmcXMB77/ ~xxl ____VJE72Ea%%A@SA x Y[@  <.( P i@ APIS.AA049AshlandJuniperus horizontalis-Arctostaphylos uva-ursi- Juniperus communis Dune Dwarf-shrublandJuniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandCEGL005064APISOuter Island15NAD835.9mC. Groebner, N. Murphy1Gentle5 degreesWHigh levelflat/beachUplandK@ plant stemsMixed evergreen - cold-deciduousMixedDwarf shrubland0.5 - 1 m <0.5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:45birchxwuunhf_!~skiQQQQQKD@@@@@@&    ____VJE12ELVAL   r " xl Keys out to above vegetation association but only Populus grandidentata is present (no Populus tremuloides).Stong component of Betula papyrifera and Populus tremuloides; narrow polygon (were we in it?).A few Pinus strobus but less than 5%. Mostly Picea mariana.Called this CEGL005044 due to dense Tsuga understory so best fit. But if more oak in canopy then CEGL002461.Maple-birch forest with significant presence of Quercus rubra; small polygon with arms so difficult to tell when in polygon. About 37% relative cover Quercus so could go either way with type (CEGL002457 is <40% rel. cover of Quercus; CEGL002461 is >40% relative cover of Quercus).Keys out easily. Prominent presence of sphagnum.Best fit with specie spresent was CEGL002479 except no red maple present. CEGL002463 fits for paper birch but doesn't have white pine.Decided to do two AA vegetations; no good fit bottomland lush shrub flowing stream, banks dense yet understory with yellow birch, sugar maple, hemlock. Species list collected for two parts of the surrounding area.Keys out easily. Site appears to have undergone significant blowdown. Chris's comments: "Took us to 10A and 11A but didn t fit"; moved on 10B confident about primary.cedar and paper birch codominate with balsam fir and sugar maple subcanopyKeys to CEGL002381 (too few trees to be non-shrub community).Mixed (>25% relative cover conifer in T2 layer); keys to CEGL005044 (although no mention of Populus grandidentata in global or APIS description; Betula alleghaniensis NOT present either; 5044 fits somewhat (but no mention of a Tsuga component). Same with CEGL002466. [Drawing of polygon on field form]CEGL005044 more hemlock than cedar.Sedge meadow with Carex spp. - no perigyniums so not sure of species. Looks like Carex lacustris.a mixed forest; best fit equal amounts of red pine and spruce; black spruce by bog margins, white spruce more upland; went with red pine canopyY7 t oa#AOSA x Y`V@ F.<( Y(k@ APIS.AA056BayfieldPopulus tremuloides - Betula papyrifera - (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach5615NAD838.4mJ. Marr, B. Dunlap1Gentle2 degreesSW240High levelflatUpland]@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 mP@##@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak711:27 AMx~|||rpi+&uplaYWCCCCC=622....````VJE16E?a$AjSA x Y]@ 2(.P2Yk@APIS.AA055AshlandThuja occidentalis-Betula allegheniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISIronwood Island15NAD837.6mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@#mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon Powershot69:20xQOOOIG6uhh\\\\TTNB=1,&$     ____VJE12E?a>#ASA x Yc@ P.PY2l@APIS.AA054BayfieldxAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APIS Sand Island15NAD839.0mJ. Marr, M. SmithGentle1 degreeNW330MidslopedepressionPalustrineSeasonally flooded@ plant stemsCold-deciduousBroad-leavedShrubland15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mz@#mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon Powershot7NAx(&&&" ugWJJ>>>*bbb`VJE12M0?a$A@SA x Y`@ (.F2PY  @APIS.AA053AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL002468? - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISOtter Island15NAD835.5mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplands@ plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mZ@#Z@-mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1064:37CEGL002466x.,, ~sskdB55))))!! RFaaa_VJE72E0/LVAL " W  X  ) )~jzsBwsSteep slope to shore but assessed bottomland aloSteep slope to shore but assessed bottomland along shoreline. Some bare bank but mostly vegetated.no cover values for individual species recordedHawkweed around margin. Beaver dam with Rosa, Cornus, and Solidago growing on it. Some open water behind dam.Long open areas of blowdowns, also birch snags. A mix of sedge and grasses <5%. Open areas have 5 m aspen and Rubus idaeus and Solidago. Herbaceous stratum is dense with a variety of species <5% cover.no cover values for individual species recordedHerbaceous layer sparse due to leatherleaf and Ledum, dominance other than Carex all other spp. <5%.Stream running N-S through polygon. Some hemlock seedlings or red maple seedlings. Mostly litter duff on forest floor. Next door paper birch and oak and maple.One large Betula alleghaniensis. Open pocket with Rhus and Alnus. Dense herbaceous stratum but not many spp. >5%.Herbaceous stratum mostly leaf litter so species listed are all less than 5%. A small pocket of tall shrub stratum hemlock.Carex oligosperma or C. lasiocarpa, Menyanthes foliata, Equisetum fluviatile, Solidago uliginosa, Sarracenia purpurea all with P cover.Looking south from AA point. Sparse herbaceous stratum due to dense Tsuga and Thuja. Several more open wet areas with ferns and Sphagnum.1-2 inch dbh balsam fir subcanopy/shrub layer. No herbaceous stratum except Lycopodium due to balsam fir. Polygon is on ridge overlooking lake and rock sandstone cliffs.Alder thicket is dry with dead/dying alder along south shore boundary. Short shrub is mostly black raspberry within alder thicket margins of spiraea and Myrica. Herbaceous stratum sparse due to black raspberry - some Fraxinus seedlings.Sphagnum mat about half rest just peat. Very dry, only small pockete of wet forest to the east - paper birch, Acer rubrum, Pinus strobus, Balsam fir; no herbaceous stratum; dense leatherleaf. East side is Alnus, rest of polygon is some mix of Myrica gale and Chamaedaphne.AA point near W end of polygon so I looked NE into polygon; forest to W is deciduous (2457); very distinctive border between polygon 75 and adjacent deciduous type; low amount of ground cover in 75; large rotting yellow birch trunks.Very wet thicket on the margin of Larix and Picea bog to the west.Cirsium arvense (P) present, also Lycopus uniflorus, Epilobium sp., and Scirpus cyperinus.Sparse understory, dense canopy between old growth yellow birch and Thuja occidentalis subcanopy.Tall shrub both species equal P. Ravine north edge of polygon.Old blowdown area along ridge; a few scattered Picea glauca. No Populus tremuloides.Lots of Acer saccharum regen (H and S1 layers).A few Sorbus in subcanopy. Dense moss mat with dense spruce stand.Mix of hardwoods in canopy with Tsuga mostly in subcanopy. Herbaceous stratum sparse, 50% litter/duff.As we walked N and out of the polygon we ran into areas with scatter oaks plus a few spots where denser.Long narrow polygon did slope to lakeshore. Mostly vegetated with open pockets of herbaceous spp. Shore has pebbles and then rock slabs to N and S of AA point. Herbaceous layer is sparse due to dense alder and birch.Point A - Streambank looking east from AA points. B - This considers ravine bank from ridgetop to bottom of ravine and stream. Herbaceous spp. Are mostly in bottom along stream. Maianthemum racemosa was only herbaceous spp. On ravaine bank under dense Taxus canadensis.Small openings with grasses and Alnus*, trail on west edge of plot. Hieracium (probably not native). Logs cut by chainsaw. Bear scat present. Hiking trail near west edge of plot. *~10x15 m opening with grass (Calamagrostis canadensis) and Diervilla lonicera ~ 20 m north of UTM point. LVAL: j 5 Ledum on margin of polygoLedum on margin of polygon due to bog next door <5%water-filled channel along eastern edge of polygonedge of polygon and adjacent shrubby "woodland" with Picea glauca, Thuja occ., Acer rubrum canopy and Alnus viridis, Betula pap., Picea glauca tall shrubsnarrow strip of polygon NE of point is forest with paper birch, fir and maple; NE & a bit SW of point is Ammophila community; rest of area (and entire polygon) is unvegetated sandPoint A - Streambank looking east from AA points. B - This considers ravine bank from ridgetop to bottom of ravine and stream. Herbaceous spp. Are mostly in bottom along stream. Maianthemum racemosa was only herbaceous spp. on ravine bank under dense Taxus canadensis.$j :a:*%ASA x Y ]@ F .(< YF2l@ APIS.AA060AshlandxAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APISMichigan Island15NAD833.3mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopebeaver pond (old)PalustrineIntermittently floodedj@plant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m <0.5 m <0.5 mDefinite CEGL002381.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1051:55x'%%%vfYYMMM5)) aaa_VJE12M?a$AGSA x Y W@ 2 #.<(  2 @APIS.AA059BayfieldLarix laricina/Alnus incana ForestCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestLarix laricina / Alnus incana ForestCEGL002471Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APIS Sand Island5915NAD836.1mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturated@5% plant stems, 30% sphagnumMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 mKeys out easily.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:31 PMx(&&&}qff^W5   smma````VJE76M?aR$ASA x Y\@ F.22( Y<l@APIS.AA058AshlandxPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002463 - Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463APISStockton Island15NAD837.5mC. Groebner, N. MurphySteep40 degreesEToeslopebankUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m @#@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:45birch, spruce, maplexxmbWWOH&z8,aaa_VJE72Ea )%A,SA x YY@ F.((PYFl@ APIS.AA057Ashlandxwet meadow mixed herbaceous mapclassCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestMixed Herbaceous Wet Meadow (map class)HWMThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISOuter Island15NAD836.8mC. Groebner, N. MurphyModerate8 degreesNBasin floorstreambedPalustrineIntermittently floodedWell-drained; small stream.plant stemsPerennialGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@&@#@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:20birch, maple - CEGL002457xthhhhhh^^SHH<<%nnnnnha]]]]]]C==1aaa_VJE72My3 a@$ASA x YY@ 2 .(<(Y<l@APIS.AA065AshlandxPicea mariana / Pleurozium schreberi ForestPicea mariana / Pleurozium schreberi ForestCEGL002447APISDevils Island15NAD837.2mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplando@plant stemsEvergreenNeedle-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mv@ #D@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photo64:00CEGL002444 - Cedar, birch, balsam fir, spruceUUU& zk`SSGGGG??9-(aaa_VJE12Ewa*$A|SA x Y\@ 2(.P Y2l@APIS.AA064AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL002461 - Quercus rubra - Acer saccharum ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Quercus rubra - Acer saccharum ForestCEGL002461APISStockton Island15NAD839.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ #h@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:35birch, maple, spruce, alderxtthhhhhhh^^SH=22*#{{{{{{^XXL%aaa_VJE72Ea$AoSA x YZ@ 22.( Fj@ APIS.AA063AshlandHudsonia tomentosa Dune Dwarf-shrubland AllianceHudsonia tomentosa Dune Dwarf-shrubland [Provisional]CEGL004024APISStockton Island15NAD833.8mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUplandZ@plant stemsEvergreenBroad-leavedDwarf shrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:50pine barren to the westx200|qddXXXXPPJ>9-(" ____VJE12EaJ9%AQSA x YY@ F.P((FYl@APIS.AA062AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002461 - Quercus rubra - Acer saccharum ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Quercus rubra - Acer saccharum ForestCEGL002461APISOuter Island15NAD837.6mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflatUpland@plant stemsCold-deciduousBroad-leavedForest20 - 35 m 2 - 5 m0.5 - 1 m <0.5 m0@ #j@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:59x\WKK???????55* ~zzzzzz`ZZN'aaa_VJE72E0y?a$A9SA x Y W@  A.PY2k@APIS.AA061BayfieldAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APIS Sand Island6115NAD8310.0mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturated@5% plant stems, 60% sphagnumCold-deciduousBroad-leavedShrubland20 - 35 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m`@ #mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:36 PMx2000'%qSSGGG<00* ~~````VJE16M}?s av$ATSA x Y@^@ < .((2Y  @APIS.AA069AshlandxAlnus incana Swamp ShrublandCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana Swamp ShrublandCEGL002381Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD835.3mJ. Marr, K. HiserGentle2 degreesVariablelow dunePalustrineV@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@*mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:32Polygon E of AA = wet meadow - Alnus, Calcan, SolixUPPPDDDDDDD::/$$ f``Taaa_VJE729E0ya#AjSA x Y@X@  F.FY< @APIS.AA068BayfieldxAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002466 - Populus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD839.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh sloperavineUpland(@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mT@*@@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:15CEGL002474 - balsam fir, paper birchx;99  }rrjcA44((((   J>bbb`VJE72E0a$A@SA x YW@ P .<(Y( @APIS.AA067AshlandxPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISBasswood Island15NAD836.7mC. Groebner, N. Murphy, B. DunlapModerate9 degreesWHigh sloperidgeUplandH@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@#V@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:11Pinus resinosa to W.xOMM70.'pccWWWWOOH<<:/%%ocaaa_VJE72EaJ$A@SA x Y\@ <.F< Y<l@APIS.AA066AshlandxPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISStockton Island15NAD833.0mJ. Marr, K. HiserGentle3 degreesSMidslopehillslopeUplandY@plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ #1@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:33Sout of polygon aspen seems to disappear.xxrpf(#      yoombZZGGGGGA:666666aaa_VJE12E0LVAL 0 d H B F0vDominant sugar maple, yellow birch, no basswood.Not enough tree canopy to be a forest so chose CEGL005277 - if forest it could be CEGL005271.CEGL002381 alder dominant, due to flooding unable to get to AA point, took GPS point on western boundary, standing water throughout polygon, flooded some Carex and grass, Impatiens capensis and Carex crinita to the north of point, more cedar and spruce border wetlandQuercus rubra in canopy, Acer saccharum in subcanopy.Keys to CEGL005227 (since influence by Lake Superior level); dominated by Alnus; eventually likely to become a CEGL002471 (Larix/Alnus forest).Center of polygon dominated by Tsuga and Thuja so fits primary vegetation. If margin has more influence it could be the deciduous community (secondary vegetation).Dominated by birch and aspen with balsam fir subcanopy and shrub layer.Tree species are scattered throughout and mostly fall into strata below subcanopy. Easy to key - fits category well. Secondary vegetation is based on tree species - although they are NOT the dominant stratum.Alder thicket is dry with mostly black raspberry short shrub layer. No leatherleaf or sphagnum. Close to shoreline but dry habitat.Dominant between Myrica and leatherleaf. Some Alnus.>25% deciduous (relative) cover so keys to CEGL005044; however if I overestimated the deciduous amount and actually <25% deciduous cover then could be CEGL002598.Keys out easily, but some influence of bog tree species.Easy to key, but significant shrub and dwarf-shrub presence so seconday call in some parts of polygon.Beaver-disturbed site; no clear dominant graminoid or herbaceous dominant.Chose CEGL005245 because more Betula alleghaniensis. Second choice - could fall here due to dense understory of Thuja occidentalis.Shrub-dominated (dominant is Alnus) with openings of Rubus, Lythrum salicaria, Solidago, etc. Keys to CEGL002381.Large component of balsam fir in subcanopyALVAL!p] o G  v + 5 < Qz/h28Standing dead tree. Seasonally flooStanding dead tree. Seasonally flooded. "Hummocks" of Scirpus cyperinus.poorly drained; standing water; saturated sphagnum mat with some pockets of standing water.Grassy opening (dry) amidst cold deciduous, lake 40m to south. Wet pockets in meadow. Mostly Calamagrostis canadensis. Bordered by subcanopy apple, alder, white birch. Other listed herbaceous equal 1%.Beach sand dune; inland pond borderd polygon.Red maple on beaver lodge/dam. Beaver cut stumps. AA point on old dam. Water-filled channels. No recent beaver activity evidence seen. Scirpus -ominated meadow with scattered T3 and S1 tree species.Shore on north side of polygon. Dry sandy beaech with some driftwood. 3 foot sand dune (treed) to the south.well-drained; lots of blowdown, recent tops of spruce and balsam fir, whole trees balsam fir and cedar; understory a mix - dense balsam fir and cedar; pockets, sparse paper birch, has Acer spicatumUpland, dry. MANY tree blowdowns; canopy gaps with Acer spicatum; standing dead cedar; some dead Taxus; a few large Abies uprooted recently.Steep and highly eroded; west-facing slope with scattered S1 shrubs (Betula papyrifera), denser shrubs near bottom of slope and in ravines; elsewhere areas of bare sand, clay, and gravel.well-drained; minimal blowdown old and recent; all herbaceous stratum <5%; dominant understory Taxus canadensis, litter/duff; Tsuga canadensis is dominant in canopy and subcanopy more yellow birch than paper birchLarge pool of water surrounded by forest and adjacent to foot path on NW side. Beaver activity prevalent in polygon; green frogs; old stumps in water; pond narrows to SE into stream.Bedrock - vegetation (minimal) growing in cracks.Dry, upland - likely somewhat wet (currently dry) down slope. Abies tree tops to NE snapped off; depression with Impatiens; recently downed trees (cedars).Moderately drained; some down trees.Currently dry; probably often wet or soil saturated.Some evidence of blowdown - mostly fallen birches. Mesic woods. Beaver-chewed stumpes; standing water in depression; moss-covered logs; giant hemlock (~33" dbh)Beaver-disturbed area. Streambank is steep (and it's right next to GPS point) but most of polygon is rolling/hummocky. Creek near point is 1-2 m wide, flowing N-S. Carex utriculatat, Juncus effusus.Poorly drained - small creek present.Dry upland; many hummocks and pockets.Mesic woods with downed trees infrequent. Foot path 10m west of point (I checked both sides of trail to complete p.2); lots of tree seedlings (Quercus, Acer saccharum); Lots of 1-2 m high Acer saccharum sapling along trail.RE: slope - GPS point is about 2m from edge of steep embankment down to lake (~40 degrees)Well-drained; some blowdown; Picea mariana tops broken off, fresh damage.Tombolo trail NW of AA point about 6 m; blowdowns; mesicWell-drained, restored herbaceous vegetationDry - probably intermittently wet.Moist soil in alder thicket some saturated areas no standing water.Mesic woods with evidence of blowdown.moderately drained; all canopy spp. <5% each; all equal 5%; south end has standing water otherwise sedge mat; a few pockets of Iris <5%wet, standing water; standing snags in sphagnum; standing water on mat with a wet pocket of ScirpusMoist mesic; area has uneven floor with ash on hummocks and depressions more moist. No standing water.Mesic woods, evidence of blowdownwell-drained; mostly red pine forest with fir and spruce shrubland sparse, bracken fern herbaceous layer, hiking trail through polygonHummock-hollow; sphagnum nearly 100%; moist site; frequent trails between hummock; many Larix about 5m tall so could go in S1 or 5-10m canopy. B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B!B   !!!!!""""$$$$''''((((())))0000111122223333344445555566666777778888::::;;;;=====>>>>>????AAAABBBBBCCCCCDDDDFFFFFGGGGGJJJJKKKKLLLLMMMMMNNNNNPPPPQQQQRRRRSSSSTTTTVVVVVWWWWYYYY[[[[]]]]]^^^^____`````bbbbcccccddddffffggggiiiikkkkllllmmmmmnnnnnoooooqqqqqssssstttttuuuuuwwwwwxxxxxyyyyy{{{{{|||||}}}}}HLVALQ [ R n kvpYI would go a the poptre-betula type here. Northern hardwoods are found only in trace amounts and the notes on the field form confirm that. However, FAM is also a possibiliI would go a the poptre-betula type here. Northern hardwoods are found only in trace amounts and the notes on the field form confirm that. However, FAM is also a possibility given that sugar maple is found in the subcanopy. Check aerial for location of polygon. 2467 should only be used in the case of stringers along sand ridges and lagoons...Looking north. Stream runs through poygon north end. Sparse understory under hemlock and cedar stands about 40% of polygon.Hummock sedge meadow. Sphagnum in places; lots of dried litter duff from Carex spp. Some standing water.Species listed here are aquatics in beaver flooding - edge spp. Are upland species that have been flooded. Surrounding forest is A. rubrum, B. papyrifera, Corylus cornuta.Walked approximately S from point to complete p.2. Also in herbaceous layer at about P level (5%) - Acer rubrum seedlings, Aster macropyllus, Clintonia borealis.No shrub layer, a few Acer spicatum. Herbaceous stratum dominated by Dryopteris. A few cedar blow downs, several large hemlocks lost their tops.Very little herbaceous spp. Those listed <5%.Field crew had a hard time with this one--needs further review with aerial photos but based on data--it is either a wiregrass or leatherleaf/sweet gale shorefenHerbaceous layer mostly Rubus pubescens with smaller amounts of bunchberry, Canada mayflower, starflower, and bluebead lilly. Betula papyrifera, Thuja occidentalis, Acer rubrum, Picea, Abies balsamea, B. alleghaniensis are in adjacent polygon.Canopy dominated by Bigtooth aspen. Understory and subcanopy is sugar maple in all strata with a mix of 5% herbaceous common spp.Canopy size about 15 m. Lycopodium obscurum = P, L. clavatum = P, L. lucidulum = P, Tsuga at NE edge of polygon (P) in polyon.Succeeding to mixed deciduous-conifer forest (Picea mariana, Larix laricina, Betula papyrifera); currently a shrubland (lots of Ledum); many Picea mariana, Betula papyrifera near S1, 5-10 m, in size; some larger Picea mariana.One-third eroding bank. Dense Populus balsamifera. A few Poacea spp. At top of bank, <5%.Herbaceous stratum sparse due to dense balsam fir canopy blocks light.Looking S and W into polygon. Herbaceous stratum sparse due to dense cedar and hemlock. Ferns in open pockets. Most understory is conifer, cedar, hemlock, and balsam fir.Herbaceous stratum had a variety of species but other than bracken fern and sugar maple seedlings, equalled 5%. Flowing stream through polygon. Hemlock present <3%, one basswood in T3.Betula alleghaniensis was about 15% absolute cover (T2).Very sparse understory mostly Thuja needles. All herbaceous spp. <5%. Some moss and sphagnum <5%.Field crew wasn't sure if in correct polygon here. If wet meadow type is the correct polygon, then wet meadow mixed is ok and it could possibly go to CEGL005174 as well since bluejoint is >25%. Plot does suggest beaver activityAlso, Acer saccharum seedlings in herbaceous stratum. One large Tsuga canadensis uprooted could have impact on AA.From AA point, I walked more-or-less east for p2 of form (not sure if in polygon) - went back to AA point and walked more-or-less north into other arm of polygon.SE of UTM plot is gully running S/NE with Acer spicatum and Alnus incana; dense pockets of Abies (S1 layer) drainage areas in plot (with Acer spicatum, Alnus incana, and Calamogrostis canadensis). Non-natives seen: Hieracium, Taraxacum officinale, Ranunculus acrisLVAL | $ ( (Z^ ~Quercus rubra is canopy; Acer saccharum is sub-canopy.Betula alleghaniensis is about 30% relative cover (>25% - therefore the mixed type CEGL002450 - but could be conifer type CEGL002449 since so close to 25% relative cover); fits description for CEGL002450 well.Easy to key - fits by floristic composition and by wet-mesic, poorly drained soil.Sphagnum bog; easy to key. Next to polygon more cedar than hemlock and birch.Part of polygon is wetland opening (wet meadow mixed herbaceous mapclass). About half or so is CEGL002457 forest type - dominated by Acer (lots of Acer rubrum) 10% Tsuga and 10% Betula alleghaniensis). Is the wetland an inclusion in the forest type or is the forest an inclusion in the wetland type or should the polygon be included as part of the larger surrounding forest polygon?Pinus strobus dominant with Quercus understory looks like hybridization between red oak and Hill's oak.Around wet pockets of Scirpus and Carex are short trees encroaching on old beaver dams, upland areas have dried Calamagrostis mat with Clintonia and Huperzia. If more canopy then wetland second choice is CEGL002071.Chamaedaphne calyculata is the dominant shrub with Myrica gale along the margin of the bog.Keys out easily with tamarack prevalent.Dominant yellow birch; <5% sugar mapleHemlock in canopy and subcanop appears to be more sugar maple in canopy, though. Sugar maple is equal to hemlock in subcanopy.Very narrow polygon, difficult to tell if in it! Therefore, may be mis-classification; appears to be mixed conifer-deciduous type; keys best to CEGL002479 but not good fit.We thought that this plot might be a mixed conifer/deciduous forest but needed 25% relative conifer cover (=12% total). It had only 20% relative (10% absolute) cover. We keyed it out as if mixed conifer/deciduous but nothing fit (so decided on CEGL002466 type). If mixed type were chosen, would need new community type.rLVAL    $ < z  X,i58Dry, probably intermittent wetland. No sphagnum noted. With CDry, probably intermittent wetland. No sphagnum noted. With Campanula aparinoides and Carex sp. (Ovales group). No sphagnum.poorly drained; sphagnum mat with cranberry and leatherleaf mostly; a few scattered scrubs; saturated bog matBlowdown area. Thuja occidentalis and Picea tops of trees, wet-mesic. No standing water.Old and current blowdown around polygon perimeter.many pockets and hummocks, some pockets are mucky.Mesic woods, downed trees prevalent. Sparse herbaceous stratum.Dry upland. Many blown-down trees in vicinity. About 20 m north of point is canopy gap with Acer spicatum.Lake cliff edge 20 m to north, evidence of past blowdown. Total herbaceous spp. listed equals 5%. Some blowdown. Open understory, no Taxus canadensis. Plot borders shoreline below.well-drained; minimal blowdown; Pinus strobus dominates with paper birch and balsam fir in canopy; old road though polygon; dominant shrub Cornus sericea under balsam fir; herbaceous layer open areas4 m from bluff/cliff. Dry upland. Bluff is sandstone 50-degree slope.poorly drained; standing water; sphagnum mat with standing water; Rubus allegheniensis around drier margin of polygon; polygon is a mix of Typha and leatherleaf with open water pockets with some Braseria schreberi <1%; there is a mix of sedges (Carex and Juncus), nothing dominantSoil saturated, many hummocks; standing dead trees.On clay bank; Well-drained; some blowdown.Dry; power (phone) line through polygon.Well-drained, some blowdown. Cirsium vulgare on shore. Sparse understory due to dense alder and cornus.poorly drained; standing water; standing snags in pond; Glyceria canadensis drier side of pond margin; herbaceous spp. on bever dam; Impatiens capensis, Solidago spp., Onoclea sensibilis all <5%; beaver pond with dam and lodgeRecently dead and snapped-off tops of Abies (T2); sparse herbaceous layer.Dry, but may be occasionally wet. Many pockets and hummocks (ground uneven but overall flat).well-drained; polygon is dominated by beachgrass with <5% short-shrub bush; dwarf-shrub sand cherry and few junipers <5%; dominant vegetation is beachgrass with <5% Elymus and Agropyron repensWet meadow disturbed by beaver activity in about 1/3 of polygon (with old stumps, standing water in channels) about 1/2 or so of polygon is forested.well-drained; not much herbaceous layer due to dense huckleberry and blueberry.well-drained, minimal blowdown; dominant herbaceous stratum is sugar maple seedlings and ferns.wet pockets with sphagnum mat and sedge and grasses; small pockets of staurated Scirpus and Carex with Acer rubrum, Tsuga, and Betula alleghaniensis.poorly drained; mostly leatherleaf but is being invaded by pines and birch with some tamarack; did not do bog map but area with trees; sparse herb layer due to dense leatherleaf; all listed are <5%Additional herbaceous species present include Asclepias syriaca, Oenothera biennis, Hieracium (non-native). Bare sand nearest lake; Ammophila zone about 30m wide; shrubs between Ammophila and Acer rubrum-Betula papyrifera forest. Juniperus communis, Arctostaphylos uva-ursi, and Acer rubrus (S1).poorly drained, standing water; <5% Larix laricina. Myrica gale only found on margin of bog mat. Some Pinus strobus and Betula papyrifera dot the bog mat.wet bog eith small pockets of stagnant water; lots of sphagnum; 2 large-dbh emergent red pinesdowned trees; many blowdowns. Dense Taxus canadensis. Herbaceous stratum sparse due to Taxus; two species linsted, Clintonia borealis and Thuja seedlings, are <5%.Lots of mature trees on ground. Old blowdown near SW corner of 1/2-hectare plot.F @ Va$ASA x Y`@ F.( 2l@APIS.AA073AshlandxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005064 - Juniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098Juniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandCEGL005064APIS Cat Island15NAD832.9mK. HiserGentle<5%VariableMidslopeduneUplandDryplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m0.5 - 1 m@*mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1053:43x  peZMM<<<<44.$$  l`aaa_VJE72E8?a-%A@"SA x Y ]@  . YFl@APIS.AA072Ashlandxwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD837.4mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aflatPalustrineSaturated@plant stemsPerennialGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@*\@ %mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:51To W - Taxus canadensis ShrublandxOMM*#!{{dYNAA555*aaa_VJE12yMa$ASA x Y^@ <.FYl@APIS.AA071AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD839.4mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplandDry, upland, levelplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mFits class wellmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1067:54xkiiicaWcccc[[UKF:5//%%%%%aaa_VJE12E0?a$A@SA x YY@ ( (.F2Y  @APIS.AA070AshlandxBetula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]CEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISRocky Island15NAD836.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandSome blowdownplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@*c@ %mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:25CEGL005245 - cedar, maple, birch~sh]]UN,y=1aaa_VJE72E+ m gAa$A@SA x Y`\@  P.(P 2l@ APIS.AA077AshlandxChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD832.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturatedPoorly drainedplant stemsEvergreenBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 mh@*@ %mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:10birch, maple, sprucexsljc% zztidXSMM55555/($$$$$$aaa_VJE12Ma6%ASA x Y[@  P.((Pdk@APIS.AA076AshlandPicea mariana-(Larix laricina)/Ledum groenlandicum/Sphagnum spp. ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISOuter Island15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLowslopeflatPalustrineSaturated@plant stemsEvergreenNeedle-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:30xkiiicaZ zztjeYTNL44444.'###### ____VJE12M?a5%ASA x YY@ P .Z Y l@APIS.AA075AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Tsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISOuter Island15NAD836.8mJ. Marr, B. DunlapGentle2 degreesVariableHigh levelflatUplandE@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mD@*@ %mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:51CEGL002457 to WestxvvvvvvlbbWLA66.'vppd1%aaa_VJE72E0a$ASA x Y W@ 2(. PYF k@APIS.AA074BayfieldAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APIS Sand Island7415NAD835.5mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturatedWet bog, lots of sphagnum.10% plant stems, 30% sphagnumCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mp@*D@ %mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:52 AMxgeee[YRnnFFF;//) ~~````VJE16M?} a$ASA x Y`@ F .22&&&&&&snb]WW?????81------aaa_VJE12Ead&%ASA x Y[@  <.(Pk@ APIS.AA080AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISOuter Island15NAD833.9mC. Groebner, N. Murphy1Gentle6 degreesEHigh slopeflat/beachUpland@plant stemsCold-deciduousGraminoidHerbaceous vegetation 1 - 2 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:15birchxj_OBB6666.." ______VJE12EaX$ASA x Y^@ F.ZY(l@APIS.AA079AshlandxChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD832.1mK. HiserFlatn/aFlat (n/a)n/aMidslopebasinPalustrineSaturated.@plant stemsEvergreenBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ *mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1052:45x(&&& vk^^RRRG;;4*%uiaaa_VJE72M0~?ap|$A@{SA x Y@^@ F.(FPY< @ APIS.AA078AshlandxAlnus incana Swamp ShrublandCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana Swamp ShrublandCEGL002381Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD834.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatPalustrineModerately well-drainedplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@*@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:15birch, sand dunexuuiiiiiii__TII==2$f``Taaa_VJE72Ey U 2 z8a$ASA x Y\@  P.(<(Yg@APIS.AA086AshlandAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APISStockton Island15NAD8312.0mC. Groebner, N. MurphyModerate10 degreesSEToeslopevalleyPalustrineSemipermanently flooded poorly drained; standing waterplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m 1 - 2 m <0.5 m@*mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:00x(&&&~qqEEE,   }}____VJE12Mx?an$A@$SA x YW@ P .(F Yl@APIS.AA085AshlandxQuercus rubra - Acer saccharum ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestQuercus rubra - Acer saccharum ForestCEGL002461Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISBasswood Island15NAD8310.0mC. Groebner, N. Murphy, B. DunlapGentle1 degreeVariableHigh slopeflatUpland#@+plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 mj@ *}@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:51Cold-deciduous throughoutxzuii]]]]]]]SSH=2''}}}}}}`ZZN aaa_VJE72Ea$AiSA x Y\@ <.PFk@APIS.AA084AshlandPinus reinosa/Vaccinium spp. ForestPinus resinosa / Vaccinium spp. ForestCEGL002443APISStockton Island15NAD838.8mC. Groebner, N. Murphy1FlatFlat (n/a)High levelflatUpland@+plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m0.5 - 1 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:25pine, birch, cedar, maplexxmmeVK>>2222**$  ____VJE12Ea$ASA x Y`^@ F.22&&&&&&~~~kkkkkf_[[[[[[>88,_____VJE72A0{aX $AOSA x Y@W@ F .<( Y  @APIS.AA349BayfieldPopulus tremuloides - Betula papyrifera/Acer saccharum - Mixed Hardwoods ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Sand Island34915NAD834.8mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatUpland@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak1:11 PMN and E - Alnus incana swampx=;; ~~vhXKK????771%% `T````VJE76EoV nal,$ASA x YZ@  F.( Yh@ APIS.AA466BayfieldChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISLittle Sand Bay15NAD832.7mC. GroebnerFlatFlat (n/a)Low levelflatPalustrineSaturated@plant stemsEvergreenBroad-leavedShrubland@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak2:30Pinus strobus/resinosa, A. rubrum, B. papyriferazzznnnnnnnnnnnnnncUJ==111&  ``````VJE12MPoa$ASA x Y@W@ ((. (<YZg@APIS.AA465BayfieldAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APIS Sand Island46515NAD835.3mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustriner@plant stemsCold-deciduousBroad-leavedForest10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:16 AMW - Populus tremuloides; E - Acer rubrumx><<{{seUHH<<<<00* ~~````VJE16EyaX$A@ZSA x YZ@ F .( <h@APIS.AA464AshlandAmmophila breviligulata-(Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISStockton Island15NAD834.2mC. Groebner, N. Murphy1Moderate7 degreesWHigh slopebeachUpland{@plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:15beach, dwarf shrubland, pine barrensxnllF@>7wwpddbWMK33333-&""""""____VJE12Ear$AUSA x Y@^@ 2 .(PPYh@ APIS.AA463AshlandCEGL002381 - Alnus incana Swamp ShrublandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227Alnus incana Swamp ShrublandCEGL002381APIS Long Island15NAD836.5mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturated<@plant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1061:36xZXXXRPFttnddXXRR?????92......_____VJE72Mpx?a$ASA x Y^@ P .F(Yk@APIS.AA462AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestQuercus rubra - Acer saccharum ForestCEGL002461Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island73115NAD837mK. HiserFlatFlat (n/a)MidslopeflatUpland dry uplandplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:23xu7222&&&&&&&vvppfffffb[WWRRRR5//#_____VJE76E0?T 1a4^$A@0SA x Y ^@ P  .( Yh@ APIS.AA471AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS Long Island38415NAD835.6mJ. Marr, K. HiserFlat<1 degreeVariableMidslopebeachUplandb@p@plant stemsPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m easy to keymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10510:48xrgWJ>2222**#______VJE168`?a2#ASA x Y`c@ F .( Y(h@APIS.AA470BayfieldCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174APIS Sand Island15NAD835.1mJ. Marr, M. SmithFlatFlat (n/a)Basin floordepressionPalustrinePermanently flooded@plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m <0.5 mn@ 9@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon62:16Forest edge - B. papyrifera-P. tremuloidesx:88 vk[NNBBB-!!``````VJE12Mpav#ASA x Yd@ F .< k@APIS.AA469BayfieldCEGL002463 - Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463APIS15NAD836mU. GafvertGentle4%NEInterfluve/SummitinterfluveUpland"moist; gently rolling interfluveplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mn@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First Photo610:25xZUIIIIIIIIII?4) {{oooookd```````ZZN `````VJE2E7ap$ASA x Y`\@ <F2 Y< @APIS.AA468AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD838mC. Groebner, N. MurphyModerate10 degreesSWHigh slopeslopeUpland@plant stemsCold-deciduousBroad-leavedForest35 - 50 m20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak61:00birch, hemlock, maplex[VVVJJJJJJJ@@5* }}}}}yrnnnnnnQKK?_____VJE72Ea #ASA x Y@X@ <.( Yh@APIS.AA467BayfieldBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463APISMeyers Beach15NAD838.4mC. Groebner, N. MurphyGentle5 degreesNToeslopeflood plainPalustrineTemporarily flooded@plant stemsCold-deciduousBroad-leavedWoodland@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:15CEGL002466 - P. tremuloides-B. papyriferax{m]PPDDD/##   ``````VJE12M0 J4a%A@SA x Y^@ 2 (.F (Y( k@APIS.AA586AshlandCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestPinus strobus / Acer spicatum - Corylus cornuta ForestCEGL002445Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island71715NAD836.8mK. HiserFlatFlat (n/a)MidslopeflatPalustrineIntermittently floodedV@30% plant stems, 10% sphagnumEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1065:34x|||ppppppf\\QF;00(}}}}`ZZN_____VJE76M0?at$A@ZSA x Y`@ 2.F(88     aaa_VJE12Eah#AwSA x Y@X@ ( (.<2YP @APIS.AA087BayfieldxPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002381 - Alnus incana Swamp ShrublandPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Alnus incana Swamp ShrublandCEGL002381APISMeyers Beach15NAD836.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandn/aplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mMore aspen than alders@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:00CEGL002466 - Aspen, birchxiiiiiii__TI>33+$keeY;/bbb`VJE72EXLVAL4~  P B hdDespite absence of Acer in canopy (Acer saccharum is nearby but I don't think it is in this polygon) fits this class well. White pine are near edge of bank and outside this polygon so it is not CEGL002590 (also co-dominance of Betula alleghaniensis does not allow this class. Also not CEGL002598 because of this).Fits primary vegetation with some floating vegetation.This polygon has emergent Pinus strobus but equal amount of Picea mariana and Picea glauca. If Pinus strobus is dominant then choose white pine/blueberry forest.Large tombolo wetland; keys to CEGL002444 and description fits well with Pinus strobus and Pinus resinosa and Picea mariana, etc; upland dune variant in Michigan and APIS. Secondary veg type = CEGL002589 (not as good a fit); no Pinus banksiana present.Beachgrass dominant with fair amount of Danthonia.Dominant beachgrass with a fair amount of Hudsonia.Small pocket of canopy trees in middle of beaver dam polygon. Taxus was on slope sides, Betula alleghaniensis around margin of water. Pools of dammed water with somee sondweed <5%.Similar species to point APIS.184 but more shrubs, enough to make a shrubland (with some more open areas), keys to CEGL002381.Alder is tall but not real dense so sunlight penetrates to understory so dense herbaceous stratum with a variety of grasses, sedges, and forbs.Mostly cedar with paper birch, some hemlock.Standing water throughout thicket with Myrica gale, Ilex on Alder pockets intermixed. Low herbaceous stratum with dense Alder and Ilex.Pockets of poorly drained soil, dominated by impatiens but overall this is more of an upland site.Quercus rubra in canopy, Acer saccharum in subcanopy.30% Scirpus cyperinus, 50% dry with shrubs nothing dominant. A mix of shrubs of graminoids.Fraxinus is dominant with a mix of paper birch and Populus.this is a small polygon - looks like you want the juniper; narrow band not the beachgrass; assessed the narrow band next to forest; best fit even with trees mostly juniper#z 7 9a8#AQSA x Yd@ F .2Y< @APIS.AA094BayfieldxPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS15NAD835mU. GafvertModerate7 degreesNWMidslopeplant stemsCold-deciduousBroad-leavedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m1@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoLammix611:53x}}}}}}}}}ssh]QFF>0   pdbbb`VJE2?aL-%ASA x Y[@  P.((Y< @ APIS.AA093Ashlandxwet meadow mixed herbaceous mapclassCEGL002186 - Cornus sericea - Salix spp. - (Rosa palustris) ShrublandMixed Herbaceous Wet Meadow (map class)HWMCornus sericea - Salix spp. - (Rosa palustris) ShrublandCEGL002186APISOuter Island15NAD833.2mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturatedPoorly drainedplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@9o@%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:15birch, spruce, maple; oak and aspen to north.xjeYYMMMMMMMCC8--!!sssssmfbbbbbbHBB6aaa_VJE72Mya:$A4SA x Y^@ <.<<<7333333____VJE12MaVy$ASA x Y `@ 2(. g  h ` 8 a rYN|=could be some Eleocharis sp. but unable to ID; Could not get to AA point on north end due to deep water so accecould be some Eleocharis sp. but unable to ID; Could not get to AA point on north end due to deep water so accessed polygon at south end; took GPS point and information there (south end); UTM coordinates were not available.All tall shrubs list as a group together equaled 5%. Myrica gale to the south and east. Has inland pond outside polygon.Some Lathyrus ju(??) but <5%. Some Elymus canadensis but <5%.Populus in/near polygon's west edge; forest to north of point more intact than elsewhere with canopy gaps.Blowdowns old and recent of cedar mostly hazelnut along the shore under cedar. There were no herbaceous spp. On forest floor due to dense cedar and Taxus. Shore spp. Were fireweed and impatiens capensis and Solidago gigantea.Pinus strobus and Quercus rubra are less than 5% in canopy. Sparse understory, all listed speecies are <5% in herbaceous stratum.Bog mat with leatherleaf and pitcher plants. Alder and Myrica gale along margin.Surrounding forest with Acer rubrum and Tsuga canadensis.Pine barrens with Jack pine dominant and Vaccinium and Corylus shrubs with some juniper. Due to dense shrub layer, very few herbaceous spp. Except graminoids and wintergreen.Lots of regeneration of Acer saccharum in H and S1 layers; some of Quercus, Thuja occidentalis; other trees in canopy layer (P-level) Populus tremuloides, Acer rubrum, Tilia americana, Thuja occidentalis.Dulichium arundinacea, Triadenum fraseri, and other species. [Drawing of poly]Severe herbivory on Acer spicatum.Surrounded by Tsuga canadensis Forest. Open meadow with few trees in the canopy. Tall shrub next component Betula alleghaniensis. Mostly a mix of sedges and grass.Other herbs: Viola sp, Cinna latifolia (<5%. A narrow strip is dominated by Fraxinus nigra where Sphagnum is prevalent in herb layer (and Carex spp. And Viola, and Cinna). Rest is dominated by Thuja (and seems to be higher and less wet).Keys to CEGL005174 for eastern part of 1/2 ha; but overall it's a mix. Beaver dam near E end of polygon; E of where polygon widens = Calamagrostis canadensis wet meadow (5174), secondary name. Not sure what to do.Other herbaceous species are <5% have some Hieracium aurantiacum with Equisetum spp.Small pocket of Alnus surrounded by forest, shore, and beach dune to N, E, and S. <5% Pinus strobus and Betula papyrifera. Dry soil with Carex and Rubus under Alnus and Calamagrostis in open pockets. No peat.Other canopy trees = Betula papyrifera (P), Acer rubrum (P). Small polygon = looked mostly NE of point and both sides of trail.Pond with beaver dam at south end. 50% is water and rest Carex, rushes, and some floating vegetation so could go to that association.Understory sparse in treed areas. Herbaceous spp. On feather moss.Lots <1 tall Picea mariana regeneration; Picea mariana canopy more like 15% than 20%.Some Artemisia campestris <5%. Prunus pennsylvanica <5%, Some Lathyrus japonicus <5%. Panicum spp.Pin cherry, Betula, and Picea are <5%.Vegetation is mostly on beaver dams with some Scirpus in water <5%. Pondweed, Carex spp. Along water margins other than Crinita <5%.Herbaceous stratum dense with grasses and herbaceous spp. Ash and tamarack along boundary of polygon, <5% each.Small polygon looking; mostly litter/duff with Dryopteris; no shrub layer.AA point was on line of trees and alder. Assessed alder thicket. Sphagnum mat where there is leatherleaf.no cover values for individual species recordedSmall pocket of 2-5 m height Tsuga canadensis. Herbaceous stratum is mostly litter and duff. Other than sugar maple seedlings, species are <5%.I uaa`w$A@4SA x Y@^@ F. 22Y(l@APIS.AA103AshlandxAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APIS Long Island15NAD835.3mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrineIntermittently flooded$@+plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@9 Patch of Phalaris arundinacea.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10610:42Narrow poly to E, 06 size of B papyrifera, A rubruxywwC<:0~~seUHH<<<$aaa_VJE12Ma$A@SA x Y]@ <.(PYZ b@APIS.AA102BayfieldAlnus incana Swamp ShrublandCEGL002381APISSand Point Road15NAD835C. Groebner1n/an/aFlatLow levelE@+plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@9r@<nmOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:00Black ash and tamarackxmi]]QQQQQQQGG<11&& ~``````VJE12AyaJ#AlSA x Y_@ 2(.( Yl@ APIS.AA101BayfieldxThuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISSand Point Road15NAD839.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/ahigh levelflatUplandWell-drained, some blowdownplant stemsMixed evergreen - cold-deciduousMixedForestX@9L@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:00hemlock, birch, cedarxIGG0*(!____WWQE@4/)) bbb`VJE12Ea&%A&SA x Y[@  P.(2 22l@ APIS.AA100AshlandxAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APISOuter Island15NAD832.4mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrinePoorly/moderately drainedplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@9k@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:15wetland, birchxy;6** {pk_ZTT<<<<<6/++++++    aaa_VJE12Ea$A@CSA x Y@\@ 2.2  (l@ APIS.AA099BayfieldxPinus banksiana - Picea mariana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002456 - Thuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456APIS mainland15NAD837mU. Gafvert, A. KirschbaumGentle4 degreesNhillslopePalustrineIntermittently floodedIntermittent drainage way.plant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m0.5 - 1 m <0.5 m@91@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus63:16CEGL002449/CEGL002456, some Acer rubrum.xhff<64+uj]]555SG bbb`VJE729M0! 9a$ASA x YY@ ((.2F Y l@APIS.AA108AshlandxPinus strobus / Vaccinium spp. ForestCEGL002447 - Picea mariana / Pleurozium schreberi ForestPinus strobus / Vaccinium spp. ForestCEGL002444Picea mariana / Pleurozium schreberi ForestCEGL002447APISDevils Island15NAD832.7mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandK@ +plant stemsEvergreenNeedle-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mB@ 9D@ <mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photo63:25CEGL002447 - birch, balsam fir, spruceFA55)))))) ~xx`````ZSOOOOOO4.."aaa_VJE72E0wa$ASA x YZ@ P.<Y<<l@APIS.AA107AshlandxPinus strobus / Vaccinium spp. ForestCEGL002589 - Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestPinus strobus / Vaccinium spp. ForestCEGL002444Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APISStockton Island15NAD839.1mJ. MarrGentle3 degreesSEHigh levelflatUpland:@ +plant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ 9W@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus89:50W is red pine forest; SE is large tombolo wetlandxVQEE999999/%%~wssssssVPPDaaa_VJE72E0a$AHSA x Y`@ <. Fl@ APIS.AA106AshlandxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS Oak Island15NAD835.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelbeachUpland.@ +plant stemsPerennialGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m <0.5 m <0.5 md@ 9d@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:00birch, oak, sprucexqoo[USL xxqfaUPJJ22222,%!!!!!! aaa_VJE12Ea$ASA x YY@ (. P2l@ APIS.AA105AshlandxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISRocky Island15NAD835.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aflatUplandWell-drainedplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 mf@ 9(@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photo610:10balsam fir, birch, sugar mapleYYY9200vvvvnnhhcWRLL44444.'###### aaa_VJE12yE\wa|,%A@3SA x YY@  2.  Y<l@APIS.AA104Ashlandxwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD837.6mC. Groebner, N. MurphyModerate12 degreesNEBasin floorvalley slopePalustrineSaturatedSome blowdown, poorly drainedplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mh@ 9@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak2:15CEGL005245 - birch, maple.xhffJDD=uuJJJ?33%aaa_VJE12Mo ?aX$A@zSA x Y`\@ F.(FYP @ APIS.AA112AshlandxAlnus incana Swamp ShrublandCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana Swamp ShrublandCEGL002381Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APISStockton Island15NAD838.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineModerately drainedplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@@@ <mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:35maple, birch, hemlockxssggggggg]]RGG;;0"f``Taaa_VJE72EyaN7%ASA x YY@ P .P25% deciduous (about 50% deciduous in canopy) therefore NOT CEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestSmall part of polygon is stream; most is shrub-dominated near point; east of where polygon narrows (and still 1/2 ha in part) is CEGL005174 (Calamagrostis canadensis).AA point was on line so assessed flowing stream, lowland running NE-W. Did not do bank which is a mix of Picea glauca, Quercus rubra, Betula alleghaniensis, Abies balsamea, and Acer rubrum. Some hemlock. Stream is flowing with beaver evidence Rubus occidentalis dense along the bank.Easy to key, fits category fairly well.Slightly confused about this small pocket, decided it was Alnus and not the trees.37% relative canopy cover Quercus which would make polygon CEGL002457. Since value is close to 40% could also be CEGL002461.  {!ap/%A@}SA x YX@ F .PYl@APIS.AA116AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISOuter Island15NAD833.8mJ. Marr, B. DunlapGentle2 degreesVariableHigh slopeflatPalustrineIntermittently flooded@+plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mP@@ [Drawing]mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:57Mixed conifer-deciduous; drainage to S of polygon.xy;6 qee_SSI>66"""""aaa_VJE12M0a$ASA x Y\@ 2(. >3((vppd1%aaa_VJE72E0y?  v p"ax$AYSA x Y\@ 2.( Y< l@ APIS.AA121AshlandxCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISStockton Island15NAD8315.1mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aBasin floorbeaver pondPalustrineplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 mN@ @P@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:05Surrounding forest - B. alleghaniensis, B. papyrifx}vtj,'toiiVVVVVOHDDDDDD'!!!!aaa_VJE12pxã$ASA x YY@ F.((Y l@APIS.AA120AshlandxSandstone Great Lakes Shore Cliff Sparse VegetationSandstone Great Lakes Shore Cliff Sparse VegetationCEGL002503APISDevils Island15NAD8310.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopebluffUpland3@+plant stemsCold-deciduousBroad-leavedSparse vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 m@ @All herbaceous spp. <5%mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak2:40CEGL002474 - cedar, white birch, sprucewwwNHHAreeYYYYQQJ>9-(""     aaa_VJE12Exoa~$A@iSA x Y`@ 2.<(Y2 l@APIS.AA119AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Cat Island15NAD837.0mJ. Marr, K. HiserGentle3 degreesNEHigh levelhillslopeUpland@+plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@@$@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1065:25xYWWWQOEwwkkkkccXLLH=55"""""aaa_VJE12E0?a06%AESA x YX@  F. ((Y<< @ APIS.AA118AshlandxWet Meadow-Mixed HerbaceousCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestMixed Herbaceous Wet Meadow (map class)HWMAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island15NAD833.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLowslopeflatPalustrine&@+plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mh@@@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak.64:05CEGL005044xsnbbVVVVVVLBB7,,  }}}}}}c]]Q~aaa_VJE72Eya4$ASA x Y`@ 2.<(Y l@APIS.AA117AshlandxPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationThuja occidentalis - Fraxinus nigra ForestCEGL005165APIS Cat Island15NAD837.5mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrineIntermittently flooded6@+plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@@@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1069:40x}{q3."" thhbXSGB<<22222,%!!!!!! aaa_VJE12M0?E M]all$ASA x Y ^@ F.(Pdl@ APIS.AA126AshlandxChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD835.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineModerately drainedplant stemsEvergreenBroad-leavedShrubland 1 - 2 m0.5 - 1 m <0.5 m <0.5 m <0.5 m2@@R@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:30birch, oak, cedarxUSS@:81~qqQQQQEE?4/#uiaaa_VJE72EaD%ASA x Y`[@ 22.F(FYk@APIS.AA125AshlandTsuga canadensis-(Betulla allegheniensis) ForestTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISOuter Island15NAD832.7mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUpland@+plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 1 - 2 m0.5 - 1 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:30x&$$$j]]QQQQIIC72&!____VJE12E0?a7%A SA x YX@ F .( Y l@APIS.AA124Ashlandxwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD836.1mJ. Marr, B. DunlapModerate6 degreesEHigh slopebeaver pondPalustrineSemipermanently flooded@+plant stemsPerennialGraminoidHerbaceous vegetation <0.5 m <0.5 mL@ @;@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:54Mixed conifer-deciduous throughout.x:88  ~sh[[OOO6**aaa_VJE12M0a`$ASA x Y ^@ F. (<l@ APIS.AA123AshlandxPinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestPinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002441APIS Long Island15NAD833.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@ @@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:10Jack pinexyrpi+&kkkkcc]QL@;55      aaa_VJE12Ea$A@SA x Y\@ <.F(Yl@APIS.AA122AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISStockton Island15NAD836.5mJ. Marr, K. HiserGentle1 degreeSMidslopeflatUpland Dry, uplandplant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m @ @@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1062:49xa___YWM ffff^^XNNLB::'''''!aaa_VJE12E0?b  axap$A\SA x Y]@ (.((Y l@APIS.AA130AshlandxThuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISIronwood Island15NAD839.3mJ. Marr, K. HiserFlatn/aFlat (n/a)MidslopeflatUpland@+plant stemsMixed evergreen - cold-deciduousMixedWoodland15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@El@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10611:02xNLLLEC9k^^RRRRJJD::.)## aaa_VJE12E0?a d$ASA x Y^@ (2.<2ZY  @APIS.AA129BayfieldxThuja occidentalis - Betula alleghaniensis ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISRaspberry Island15NAD833.6mC. Groebner, N. MurphyModerate6 degreesNLow levelbeachUplandWell-drained, some blowdown.plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@E@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:30cedar, birch, maplex   vk_TTLE#tnnb&bbb`VJE72EaH$A.SA x Y`@ Z.( Y l@APIS.AA128AshlandxEroding Clay Bank Sparse VegetationEroding Clay Bank Sparse VegetationCEGL002584APIS Cat Island15NAD834.4mJ. Marr, K. HiserVery steep50 degreesWLowslopeclay bankUpland@+plant stemsMixed evergreen - cold-deciduousMixedSparse vegetation 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mz@EmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1056:45Forest at top bank - B. papyrifera-dominatedxB@@  rkI<<0000((aaa_VJE12Eya.$ARSA x Y X@ < .PYl@APIS.AA127AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISManitou Island15NAD8310mC. Groebner, N. MurphyGentle2 degreesWHigh slopeflatUplandSome blowdownplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@@@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:15CEGL002457 - sugar maplex~~d][Tjjjjbb\PPNC;;#####aaa_VJE12ELVALJ~ 6 N  @~DvSettled for this classification. There is no yellow birch but paper birch <25%. There is red pine. Chose CEGL002598 because it best fit species in polygon. No red pine classification fit and other Tsuga had more hardwoods - this is mostly hemlock and pine.Polygon NE of point = CEGL005098. West of point (in campground) had scattered tall-shrub Acer rubrum, Prunus pensylvanica, and 5-10 m tall Betula papyrifera and no to little Ammophila.Tsuga is dominant with deciduous >25%.assessed Betula and Acer east and west not black ash to the southSphagnum mat with alder and leatherleaf.Dominant is bigtooth aspen with Acer subcanopy.Tag alder-dominated wetland community along drainageway; sphagnum 60%.Tsuga was about 30% relative canopy cover which would make type a mixed conifer-deciduous forest (CEGL005044). However, since relative cover was close to 25% and may be less than 25%, could be a deciduous forest (CEGL002457).Many old and new Thuja blowdowns could determine AA. Easily keys out.There are few Pinus strobus, but this may be CEGL002590, esp. with low cover for Betula only.Picea-dominated with Ledum on Sphagnum mat; with lesser amounts of Larix.Keys out easily, but with noted presence of Fraxinus sp. and Quercus rubra, as well as emergent Pinus strobus.Looking at low area dominant was Alnus incana.Keys out easily to CEGL005174. No other match for wet field or meadow.Dominant is Ammophila breviligulata grassland.Easy to key. Coordinates are about 10m soutwest of point. Photos are (1) from above about 12 m SW of point and (2) from same point north and (3) from same point SE.CEGL002449 primary because more cedar but then chose secondary because of Abies balsama in many strataKeys best to CEGL002450, although woodland amount of canopy trees.Polygon is dominated by Thuja occidentalis with birch, fir, and spruce subcanopy and canopy.Overall vegetation about 10-20% so doesn't key to CEGL002913. :4aD*$A@SA x YZ@ < 2.( YFl@ APIS.AA135BayfieldxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISLittle Sand Bay15NAD835.1mC. GroebnerModerate10 degreesNMidslopehillslopeUpland/@+plant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m\@Ez@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:33Alder thicket and Myrica galexkiiJDB;zzzzrrg]][OEE888882+'''''' bbb`VJE12Exa#AOSA x Yc@ - (( YPl@ APIS.AA134BayfieldxCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APIS Sand Island15NAD835.2mJ. Marr, M. SmithVariableBasin floorbeaver pondPalustrineIntermittently flooded@+plant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m <0.5 m <0.5 m [Drawing]mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon79:46Forest edge;T2=B. papyrifera, A. rubrum; T3=B. allxJE........$|ooeeeeRRRRRLEAAAAAA(""""bbb`VJE12Mpad$A@SA x Y`^@ ( .(Fl@ APIS.AA133BayfieldxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISSand River wetland area15NAD835mC. GroebnerModerate10 degreesN360Low levelbeachUplandn@+plant stemsPerennialGraminoidHerbaceous vegetation 1 - 2 m <0.5 m <0.5 m!Dominant species is beachgrass.?@<mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:00Dune habitat with birch, pin cherry, alder, red maxsljc% zzshcaUKK>>>>>:3////// bbb`VJE12Ea%A SA x Y^@ Z.Yl@APIS.AA132AshlandxEroding Clay Bank Sparse VegetationEroding Clay Bank Sparse VegetationCEGL002584APISStockton Island15NAD835.9mK. HiserVery steep50 degreesNEHigh slopebankUplandHighly erodedplant stemsCold-deciduousBroad-leavedSparse vegetation10 - 15 m 2 - 5 m 1 - 2 m <0.5 mH@EmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1041:23x qcSFF++++## aaa_VJE12E~?ah-%ASA x Y[@ 2(.F< 66"""""aaa_VJE12E0a $ASA x YW@ F FPY k@APIS.AA141BayfieldAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Sand Island14115NAD834.9mC. Groebner, N. Murphy, B. Dunlap1FlatFlat (n/a)High slopeflatUpland@Iplant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@EmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak61:35 PMxecccZXQxxxxppj^^RRLJ'''''!````VJE16E?7 H cMa $A@SA x Y X@ .F<Yl@APIS.AA148AshlandxThuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISManitou Island15NAD837.5mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandMajor blowdown.plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ EmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:20CEGL002457 - Yellow birch and sugar maple.x{yyMGE>zz]]]]UUOC>2-'' aaa_VJE12Ea&%ASA x Y[@  P.((Zg@APIS.AA147AshlandChamaedaphne calyculata - Myrica gale/Calex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISOuter Island15NAD832.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@Iplant stemsEvergreenBroad-leavedDwarf shrubland0.5 - 1 m <0.5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:05xJHHHB@9ssmb]QLFF.....(!____VJE12M?aN %ASA x Y@]@ F . >&&&&& aaa_VJE12E' aj(%AmSA x Y ]@ 2.(<Y442&aaa_VJE12Ea$ASA x Y]@ F . ( Yl@ APIS.AA159AshlandxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISIronwood Island15NAD832.4mJ. Marr, K. HiserGentle1 degreeSMidslopelow duneUplandDryplant stemsPerennialGraminoidHerbaceous vegetation10 - 15 m 2 - 5 m <0.5 mp@E [Drawing]mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1051:10Forest edge=10-15 m tall A. rubrum and B. papyrifex]WUK zzzzrrh^^\RJJ777771*&&&&&& aaa_VJE12Eat$ASA x YZ@ F.< <<<<64-}ppdddd\\VJE94.. ____VJE12E?LVAL   V : h>lKeys to CEGL002444 (Michigan Inland Dune Ridge variant) although >25% cover of other conifer spp compared to white pine.Does not key easily. Deciduous type (based on canopy layer); mixed if combine canopy and subcanopy; keys more or less to CEGL002466 (although 20% cover of northern hardwoods) if deciduous type (no mention either of Thuja in description); CEGL002474 (mixed type) descriptions fits better so made it primary name.A tough choice between oak dominant or Tsuga . Best fit is oak. Would be CEGL005044 if oak were dominant.Deciduous forest with strong component of Quercus; primary name is CEGL002457; secondary name could be CEGL002461 type but didn't seem like enough Quercus (40% relative cover).Keys to CEGL002257; wet meadow dominated by sedge species (very low amount Calamagrostis canadensis).mostly Calamagostis canadensis with beaver pond about 25% of polygon and vegetation, bordered by cedar, spruce, and balsam fir, CEGL005174 is open water with Potamogeton, area covered by Calamagrostis canadensis and Scirpus cyperinusKeys to CEGL002450 (because >25% relative cover deciduous (33%)). But since it's close to 25%, secondary type with <25% deciduous could apply.Beaver meadow? Graminoid/herb-dominated (Calamagrostis canadensis; lost of Scirpus cyperinus, too).Mix of Thuja and birch with Taxus and Acer spicatum understory.Easy to key; fits class well except high Betula papyrifera cover. NOTE: Betula papyrifera more abundant than Betula alleghaniensis. Greater cover leads to seconday vegetation name.thin band (polygon) along wetland; this thin band between leatherleaf shrubland and pine forest; this area has been mostly red pine with spruce subcanopy gave it CEGL002589 primary because of understory spp. but could easily have been CEGL002443north of point = less cover shrubs, mostly graminoids. south of point dense Alnus (see diagram).Dominant species are Scirpus and Phalaris.  aFb$A@KSA x Y^@ ( (.F2FY @APIS.AA166BayfieldxThuja occidentalis - Betula alleghaniensis ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISRaspberry Island15NAD832.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drained, major blowdownplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m~@Oo@ HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:55spruce, birch, maple, cedarx$""{pdYYQJ(tnnb&bbb`VJE72Eaj$A@ SA x Y`@ <.P 2Y @APIS.AA165AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Cat Island15NAD837.1mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatUpland Dry, uplandplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 mh@OmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10611:57xuj_TTLE#A5aaa_VJE72E0?a*$AMSA x Y]@ <.Z  Yg@APIS.AA164BayfieldThuja occidentalisThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISSand Point Road00215NAD836.0mC. Groebner, N. MurphyFlatFlat (n/a)Low levelUpland@ Iplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:15xxmmeVK>>2222***  tt````VJE16D0?a$A=SA x YZ@ (<.<<F2k@APIS.AA163AshlandPinus banksiana-Pinus resinosa-Pinus strobus Dune ForestCEGL002443 - Pinus resinosa / Vaccinium spp. ForestPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589Pinus resinosa / Vaccinium spp. ForestCEGL002443APISStockton Island15NAD832.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandminimal blowdownsplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@OmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:00bogxwrrrffffff\RH=2'zsooooooRLL@ ____VJE72E07x 0 Ma|.%ASA x Y ]@  P.(YF @ APIS.AA170AshlandCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationWet meadow mixed herbaceous mapclassCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174Mixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD836.2mC. Groebner, N. Murphy1FlatFlat (n/a)Low levelbeaver pondPalustrineSaturated`@Iplant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@OmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:40spruce, Balsam firxlggg[[[[[QG==2''''{tppppppSMMH____VJE72Mx~a$ASA x Y`@ <.<<<(Yl@APIS.AA169AshlandxThuja occidentalis - Betula alleghaniensis ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Cat Island15NAD838.0mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUpland@Iplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@O@ HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10611:57xyymmmmmmcYYNC8--%smma%aaa_VJE72E0?a/%ASA x Y[@ F.( Y< @ APIS.AA168Ashlandwet meadow mixed herbaceous mapclassCEGL002282 - Potamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMPotamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationCEGL002282APISOuter Island15NAD835.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturateda@ Iplant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 mpondweed collectedmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:30x]X888888888....... zvvvvvv\VVJ____VJE72MF?a$A@SA x Y\@ ((.(YP @ APIS.AA167AshlandxCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationWet meadow mixed herbaceous mapclassCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174Mixed Herbaceous Wet Meadow (map class)HWMAPISStockton Island15NAD836.6mJ. Marr, K. HiserFlatn/aFlat (n/a)n/achannelPalustrineIntermittently floodedw@ Iplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@O@ HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10510:14Surrounding Forest=B. papyrifera, A. rubrum.xlg[[OOOOOOE;;0%%%%}vrrrrrrUOOJ!aaa_VJE72yMpx$ :a$ASA x Y\@ 2(.P2 Y2l@APIS.AA174AshlandxQuercus rubra - Acer saccharum ForestCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestQuercus rubra - Acer saccharum ForestCEGL002461Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD833.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ O@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:20hemlock, oak, birchxtthhhhhhh^^SH=22*#{{{{{{^XXL aaa_VJE72Ea6$ASA x Y`@ P .FY  APIS.AA173AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Cat Island15NAD836.8mJ. MarrGentle2 degreesNNELowslopeflat%@Iplant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m`@ OS@HOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus612:55x<:::31(|l__SSSSSSMCC>3++"""""aaa_VJE12A0P>a $AMSA x Yc@ -2.< 2 Y<l@APIS.AA172BayfieldxFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island15NAD837.1mJ. Marr, M. SmithGentle1 degreeN20LowslopeflatPalustrineSeasonally floodedT@Iplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 mKeys readily to CEGL002105mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon78:38x|>999}}wmig]UUBBBBB<5111111bbb`VJE12M0?a $ASA x Y`@ F.(YPl@ APIS.AA171AshlandxCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APIS Cat Island15NAD8310mJ. MarrFlatn/aFlat (n/a)n/aMidslopebeaver pondPalustrineSeasonally flooded@Iplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m <0.5 m@OQ@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus62:30Surrounding forested edge=Thuja, Abies, Betula papxrlja#~toc^XXOOOOOJC??????'!!!!aaa_VJE12M0X7  %MaFm$AԿSA x Y ^@  F.P2 (( @APIS.AA178AshlandxPinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestCEGL002443 - Pinus resinosa / Vaccinium spp. ForestPinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestCEGL002520Pinus resinosa / Vaccinium spp. ForestCEGL002443APIS Long Island15NAD838.7mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m!Dominant red pine with Quercus.@@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:00Cedar, oak, alderx=;;(" ti]RRJC!||pH<aaa_VJE72Ea$ATSA x YZ@ P <2Y22l@APIS.AA177AshlandxPinus strobus / Vaccinium spp. ForestPinus strobus / Vaccinium spp. ForestCEGL002444APISStockton Island15NAD836.0mJ. MarrFlatn/aFlat (n/a)n/aHigh levelflatUplandTombolo Trailplant stemsEvergreenNeedle-leavedForest20 - 35 m15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ O^@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus810:30E is tombolo wetland expanse.xQOO0)'xpaVII....&& aaa_VJE12E0aF$ASA x Ya@ (.<2(FY @APIS.AA176AshlandxAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISOtter Island15NAD839.4mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUpland@Iplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mn@ OG@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10610:44xzzodYNNF?=1aaa_VJE72E0?a'%A SA x Y ]@ 2(.(<(Y2 @APIS.AA175AshlandTsuga canadensis-(Betua allegheniensis)ForestCEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Tsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISMichigan Island15NAD833.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUpland$@Iplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:45xlggggggggg]SSH=2''~~~~~~a[[O____VJE72E? i  a^#AuSA x Yc@ 2.P2Yl@ APIS.AA182BayfieldxThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002456 - Thuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456APIS Sand Island15NAD8310mJ. Marr, M. SmithGentle1 degreeEMidslopeflatUplandT@Iplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mh@UmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon75:37(?)XvllaVK@@8)?3bbb`VJE72E0?a;%A!SA x YX@ ( (.((YP2 @ APIS.AA181Ashlandxwet meadow mixed herbaceous mapclassCEGL002257 - Carex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISOuter Island15NAD834.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineIntermittently flooded.@Iplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m!No dominant herbaceous /sedges.@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak72:10CEGL05044 - birch, maple, hemlockxDBBujj^^SE5((vaaa_VJE72Mya* $ASA x Y`^@ 2.( YZl@ APIS.AA180BayfieldxCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APIS mainland15NAD835.7mJ. MarrGentle1 degreeNWLow levelflatPalustrineIntermittently flooded@Iplant stemsPerennialGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m@Uc@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus62:15To W is water-filled channels with Nuphar, etc.xtnlc% ynnj`XXOOOOOIB>>>>>>(""""bbb`VJE12MP`au$ASA x Y@^@ < .(<(Y( @ APIS.AA179AshlandxAlnus incana Swamp ShrublandCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana Swamp ShrublandCEGL002381Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD835.8mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrine4@Iplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m Easy to keymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10612:12xgbbbIIIIIII??4))f``Taaa_VJE72E0y?LVAL`  2 .BD&No Tilia americana seen in CEGL002457. NOTE: Cover of individual taxa estimated using RELATIVE COVER, by stratum.Deciduous type; Quercus about 15% (<40% relative cover) therefore not CEGL002461.Keys to CEGL005125 (Great Lakes Pine Barrens); polygon lacks Pinus banksiana.Hemlock dominant, a few hardwoods.Keys to 40B (permanently flooded); no clear dominant emergent graminoid or herbaceous speciesFraxinus nigra-dominated forest; Thuja in subcanopy but less than 25% cover; keys easily to CEGL002105.Ash in canopy with alder below; some open pockets with goldenroc and reedgrass. This might not be representative of the polygon, more trees to northwest and west are ash so could be CEGL002105.Enough birch to put it in this AA class.Difficult to classify because polygon comprised of forested portions and beaver disturbance areas in varying degrees of succession.Nothing fit so settled for this AA.Tree canopy >25% absolute cover; woodland physiognomic class.Keys to CEGL002447 readily; canopy cover fits description for 1 plot previously on Stockton Tombolo in 2005; however, Sphagnum is dominant moss in polygon APIS.190.A mix of hemlock, birch, and oak.Old beaver dams surrounded by hemlock and sugar maple and yellow birch on the upland border. Yellow birch as tall shrub is dense but mostly water so no dominant speciesCedar is dominant with birch, maple, ash in canopy. Some spruce.Easy to key. But note high cover for Acer saccharum in canopy and Betula are dead or dying.Not enough shrubs for shrubland; graminoid-dominated mostly (Calamagrostis canadensis) so keys to CEGL005174; forbs common, also.Deciduous forest with LOTS of Abies in S1 and 5-10m strata (some in 06); keys to CEGL002457 eventually likely to become mixed deciduous-conifer (Abies) forest.Keys to CEGL002449/CEGL002456 (<25% deciduous cover)Keys to CEGL002257, however a much wetter version than other examples this type. a0$AOSA x Y\@ <.P2Y<k@APIS.AA187AshlandTsuga canadensis-Acer sacchrum-Betula allengheniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD839.8mC. Groebner, N. Murphy1FlatFlat (n/a)High levelflatUplandT@Iplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mleaves defoliated on maplemjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:15birch, maplexomm_YWP  ~qqeeee]]WKK??97____VJE12Ea$ASA x Y_@ (2.F2((YFl@APIS.AA186BayfieldxThuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISSand Point RoadMeyers Beach15NAD839.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drained, some blowdown.plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 1 - 2 m0.5 - 1 m <0.5 m@Ud@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:30Birch, maple, aspen.x{yr4/##  yyyyqqk_ZNICC+++++%bbb`VJEq2Ea(%ASA x Y^@ <.F2Y2l@APIS.AA185AshlandxThuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISStockton Island15NAD836.6mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatUpland5@Iplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m@U@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10612:36x@>>>75+gZZNNNNFF@61%  aaa_VJE12E0?aw$ASA x Y@^@ P.( YF l@ APIS.AA184AshlandxCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174APIS Long Island15NAD832.4mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrineIntermittently flooded@Iplant stemsPerennialGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 m@Uc@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10510:12Very narrow poly S of 184 - row of wet shrubs.xlecY  vjjdZUID>>+++++%aaa_VJE12MxaL$A@.SA x Y^@ P.F(<Yl@APIS.AA183BayfieldxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS mainland15NAD836.6mJ. MarrGentle3 degreesNNWMidslopehillslopeUpland Dry uplandplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m>@UmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus610:02xMKKKDB9ww____WWLBB=2**!!!!!bbb`VJE12E0? ~ a* $ASA x Y@c@ Z.( YZ @APIS.AA191BayfieldxPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APIS Sand Island15NAD837.1mJ. Marr, M. SmithFlatn/aFlat (n/a)n/aLow leveldepressionPalustrineSaturated@Iplant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mz@ UmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon75:43Xwuuuomf(### vkfZUOO<<<<<6/++++++    bbb`VJE12M0?ar$ASA x YZ@  Z<(88     aaa_VJE12E_aTA%ASA x YX@  2.(< Y2 @ APIS.AA188Ashlandxwet meadow mixed herbaceous mapclassWet meadow mixed herbaceous mapclassAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071Mixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD833.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopebeaver pondPalustrineSaturated Some blowdown; poorly drained.plant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m 1 - 2 m <0.5 m <0.5 mP@U\@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photo62:15CEGL005003 or CEGL005245xql``TTTTTTJ@@5****||ddddd^WSSSSSS933.aaa_VJE72MxwzLVAL 6 . S a mz&z2; ksStanding water around margin wetland, wide area including Typha and Myrica gale. Center Standing water around margin wetland, wide area including Typha and Myrica gale. Center is sphagnum mat with leatherleaf, pitcher plant, and some sedges. Alnus along bog margin.Deschampsia flexuosa <5%; Barren strawberry <5%.Short shrubs combined species equals P. Pockets of wet meadow with Calamagrostis canadensis. Canopy fairly open with Alnus in wet pockets and Populus tremuloides in dry areas. Pocket of green ash.AA point looks like AA is the Alder thicket not trees or beachgrass. Alder thicket is dry, not sphagnum mat. No peat but close to shore so gave it swamp AA.There is about 10% pocket of sedges and grasses.Several open pockets with bracken fern and Solidago. Dead snags. Ravine to west. Pole size maple and paper birch. Herbaceous stratum mostly litter-duff due to dense balsam fir shrub layer.A bit more Picea than larix in all layers (S1, S2, T3).Quercus rubra (P) is canopy; lots blowdown; standing dead birch trees.no cover values for individual species recordedDrainage has stagnant pools of gooey water.Looked south into polygon from point. Acer rubrum noterd (not A. saccharum).Steep ravine to the norht, hemlock on slope. Sparse understory mostly litter/duff. Next door is paper birch/maple.cover values not recorded for species or strata below short shrub except nonvascularCanopy is made up of red maple and hemlock with subcanopy of cedar and red maple. No shrub layer. Fern is the dominant herbaceous layer.Large amount of Pinus strobus in canopy but Picea mariana is in canopy and subcanopy. Herbaceous stratum is sparse due to dense cedar.Looking north into polygon. Understory 50% litter/duff. A mix of Alder, Acer, and a few conifers and ash.Thuja occidentalis - P in T2 layer. Some Thuja and Tsuga on/near edge; LOTS of Fraxinus W of AA point, none NE of AA point.Defoliation by caterpillers. Most herbaceous stratum is sparse mostly litter-duff. Walking to the north of point there is a large area of paper birch completely defoliated by caterpiller even the sugar maple seedlings are eaten; understory spp. Just litter/duff.S of 214 (top of bank and back from edge) = Forest of mostly Betula papyrifera (Abies subcanopy), some cedar.Point is in the NE corner - assessed Sout had Westn into cedar and aspen. Next door ash and cedar. Stand sags of balsam fir could impact veg assoc.I checked "woodland" in Physiognomic Class section (since not enough trees to be a forest).Under largehemlock very little vegetation in the herbacesou stratum butthere are a feai amount ofhemlock saplings. Red maple, sugar maple, cedar, hemlock seedlings.Floating leaf unknown - could be Glyceria borealis.About 10% shrubs - Betula papyrifera lining upper edge of polygon at tree line and in crevices on ledges. Species list above estimated from boat therefore NOT complete at all.Inclusion of Populus tremuloides to west of UTM point about 10 m (visible in photos).Lots of Acer seedlings; red and sugar maple (T2) both present (cover classes may not be totally accurate, e.g. sugar could be 02; red 03).Drainage (Betula alleghaniensis, Fraxinus nigra, cedar in subcanopy)Dense shrub layer at least in northern part of polygon; other herbaceous species = Iris versicolor, and Pteridium aquilinum. I walked south in polygon (at about 56456/5199320, the polygon was less shrubby, higher and drier (with Pteridium), more blowdowns, more red pine, but still lots of black spruce; in general in 1/2 ha area black spruce is most common conifer by far, followed by red pine. East of polygon is expansive tombolo wetland; W of polygon is red pine forest with black spruce subcanopy.QC gaRb$A.SA x Y^@ 2 (.<(ZY  @ APIS.AA195BayfieldxThuja occidentalis - Betula alleghaniensis ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISRaspberry Island15NAD835.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mP@ U<@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:20cedar, birch, maplexvvk`TIIA:  tnnb&bbb`VJE72Ea=%ASA x Y`[@ F.(Yg@APIS.AA194AshlandEroding Clay Bank Sparse VegetationEroding Clay Bank Sparse VegetationCEGL002584APISOuter Island15NAD833.0mC. Groebner, N. Murphy1Somewhat steep40 degreesNLowslopebankUpland@Zplant stemsMixed evergreen - cold-deciduousMixedSparse vegetation 5 - 10 m 1 - 2 m0.5 - 1 m <0.5 m`@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:00x xqOBB6666..(____VJE12Ey?a+%AiSA x YX@ 2 .( Y(l@ APIS.AA193Ashlandxwet meadow mixed herbaceous mapclassCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestMixed Herbaceous Wet Meadow (map class)HWMTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISOuter Island15NAD838.6mJ. Marr, B. DunlapGentle1 degreeVariableHigh slopebeaver pondPalustrineIntermittently flooded@Zplant stemsPerennialBroad leaf herbaceousHerbaceous 2 - 5 m 1 - 2 m <0.5 m <0.5 m@ U>@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:07Mixed conifer-deciduous throughout.x~ymmaaaaaaWMMB7777+ }vrrrrrrXRRFaaa_VJE72Mxa $ASA x Y X@ (<Y @APIS.AA192AshlandxPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISManitou Island15NAD838.5mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandSome downed trees.plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mF@ U3@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:55CEGL002457x"    }rg_X6))    |9-aaa_VJE72EbLVALu D z 1 y-tH lwell-drained, major blowdown; recent blowdown with hemlock and cedar, old-growth hemlock, sparse hewell-drained, major blowdown; recent blowdown with hemlock and cedar, old-growth hemlock, sparse herbaceous stratum due to Taxus and cedar, hemlock canopy; open areas have Dryopteris and Acer spicatumMoist site; lots of blowdown; stand of paper birch on higher ground about 30-40 m to NW. Looked SW from AA point to complete P.1. Walked SW and up narrow drainage for P.2.Evidence of blowdown. Lakeshore about 75 m to north. Blowdown is mostly Betula papyrifera. Rotting stumps.poorly drained; mostly Chamaeadaphne; half some small treesWet; no open water; very low spp. Diverstiy; dense Chamaedaphne cover.poorly drained; standing water; vegetation ratio 5 to 1; several islands of sphagnum mat with sedge and spp.; Eleocharis robbinsii most likely but could not confirm ID; Bottom is muck with very little vegetation; there is some Brasenia and Eleocharis presentRecently downed canopy Abies; wet soil; lots of SphagnumDry-mesic site; very shaded site; sparse herbaceous layer; some standing dead trees (Abies and Thuja); several snapped off tree tops (T2 Abies).Dry; aspect variable (small rolling rises throughout polygon).Dry; heavily eroded; steep N-facing caly slope; parts of polygon west of AA point with greater than 10% cover.Unvegetated surface >100% beause litter/duff was under some of the CWD which was suspended.Lots of recently snapped off Abies (T3, T3); much more Abies in recent past; lots of Taxus (less than 1/2 m tall); sparse herbaceous layer.Dry. Trails run through polygon; probably more or less occasionally disturbed by campers/visitors. Dense dune grass with scattered betula papyrifera (T2, T3, S1) and other S1 species.Dry; wetland openings east of point and west of point (see diagram on p.2)poorly drained; standing water; dominated by Calamagrostis canadensis and Carex spp.; dead snags clutter wet medow; saturated, created by beaver; along north boundary sphagnum is dryStanding dead Betula papyrifera; lots of Alnus viridis on bank; succeeding to birch-fir forest type.AA point on old beaver dam; most of polygon (and 1/2 ha area near point) = mucky water-filled beaver pond; standing dead trees; graminoids emergent on edges; old beaver lodge about 40-50 m NE of AA point; permanently flooded.Sandstone ledge and boulders. Plants are in crevices mostly.Sand beach within 50 m to north. Moist clay soil. Seems drier than expected; no standing water. Dryopteris, Equisetum, Matteucia present but infrequent. Prunus species present but rare. Clump of Lonicera (possibly exotic) about 20 m south of UTM point. Several Fraxinus nigra. Other shrubs include Cornus sericea and Rubus (raspberry?).Wet meadow opening surrounded by forest with E-W running drainage south of point (out of polygon). Some evidence of beaver activity; water-filled channels; tree stumps on "islands" with S1 size Tsuga, Acerrubrum, and Betula alleghaniensis.Dry; LOTS of dead brown Taxus; some recent blowdowns (T2 size cedar)Wet; saturated, wet soil (muck); no open water.Very wet site, especially in spring; some Sphagum seen; Alnus ranged from 1/2-2 m in height; Myrica and Chamaedaphne to about 1/2 m tall.eroding clay bank; several cuts in bank- drainage to lake dry; clay bank with bedrock below along shoreline; mostly clay and rock; dominant vegetation is Populus balsamifera from tall-shrub to seedling stratum; cliff ridge is Pinus strobus and Betula papyriferaPolygon is narrow drainage with NARROW stream; parts of it are forestsed (Tsuga, Acer rubrum, and Betula alleghaniensis); with intermittent openings of Scirpus cyperinus (probably) forbs, and S1 shrubs (Salix, Betula alleghaniensis, Tsuga, Thuja).H A a$ASA x Y^@ <(.(2l@APIS.AA199AshlandxChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD833.3mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrineSaturated1@Zplant stemsPerennialGraminoidHerbaceous vegetation 1 - 2 m <0.5 m <0.5 m <0.5 m(@\mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1059:36xTRRRLJ@wkke[VJE??55555/($$$$$$aaa_VJE12M?a$A@SA x Y\@ <.F( Y(l@APIS.AA198AshlandxFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APISStockton Island15NAD833.3mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturatedPoorly drained soils.plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@UF@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F106~4:15xOJ>>222222(toc^XXEEEEE?8444444aaa_VJE12M0?a>$ASA x Y`^@ 2 .(2PY( l@ APIS.AA197BayfieldxAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Sand Road15NAD836.9mJ. MarrGentle1 degreeWLow levelflatPalustrineSeasonally flooded@Zplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 mKeys to CEGL005227.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus611:43xljjjcaXthhbWWUKCC:::::4-))))))    bbb`VJE12Mx?aZ$A@SSA x Y_@  F.(P YZl@ APIS.AA196BayfieldxAlnus incana Swamp ShrublandCEGL002105 - Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestAlnus incana Swamp ShrublandCEGL002381Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APISSand Point RoadMeyers Beach15NAD837.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineIntermittently floodedPoorly drainedplant stemsCold-deciduousBroad-leavedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@ U{@HmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:40ash, birchxxmmeWG::mgg[ bbb`VJEw2MLVAL @(Mostly aspen in canopy with equal amounts of maple, birch, and cedar. But if cedar is considered the key tree even though it is in subcanopy then CEGL002450 would fit.Shrub (Pinus banksiana)-dominated community (dense in places; sparse elsewhere; doesn't key well but CEGL002589 description fits fairly well (although APIS.208 is earlier successional stage.Type actuall birch-fir shrubland but no type in key that fits this. UTM coordinate about 20 m south of AA point (to of VERY steep clay bank; type =non-sparsely vegetated clay bank (dense S1 and 5-10 m tall tree layer); put CEGL002584 as best type even though much more than 10% cover.We did AA point from boatusing binoculars. Type is definitely CEGL002507. UTM coordinates are estimated from boat about 50m north of actual AA point on shore.Keys out to alder swamp easily. Early spring thicket not completely leafed out; could be more % cover later in summer; pockets of red-osier dogwood.Half of plot is beaver meadwo, other half is mostly forested with Acer rubrum and Tsuga canadensis; IF greater ratio of forest to opening, would have gone with forested type (Acer rubrum dominated with Tsuga canadensis) no clear dominatn, graminoid or herbaceous species (Calamagrostis canadensis and several sedge species present).Difficult to key - is sphagnum <25% cover (in couplet 39), this leads to CEGL002257 - but species composition and description don't match at all. To get to CEGL005228 - sphagnum >25% (but it's not though the description says it may not be, and choose between shrubs and trees dominant (clearly herbs are dominant here but this is not an option in couplet 45 - which should be re-numbered as there are 2 couplet 45s). Also, in couplet 48 it's not clear what the difference is - had to read the descriptions - then I saw that it fit the description for 5228 well (with low Sphagnum and high Rhynchospora % cover, which is what the description says it may have!). z #qa#A*SA x Y`c@ P .( Y @APIS.AA204Bayfieldxwet meadow mixed herbaceous mapclassCEGL002282? - Potamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMPotamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationCEGL002282APIS Sand Island15NAD834.0mJ. Marr, M. SmithFlatn/aFlat (n/a)n/aBasin floorbeaver pondPalustrinePermanently flooded@Zplant stemsPerennialGraminoidHerbaceous vegetation <0.5 m <0.5 m@U5@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon71:46xkfZZNNNNNND:::::::# }yyyyyy`ZZN bbb`VJE72M?ad$A0SA x Ya@ Z .( Yl@APIS.AA203AshlandxSandstone Bedrock Great Lakes Shore Sparse VegetationSandstone Bedrock Great Lakes Shore Sparse VegetationCEGL002507APISNorth Twin Island15NAD83J. Marr, K. Hiser, T. GostomskiNHigh slopeledgeUpland>@Zplant stemsCold-deciduousBroad-leavedSparse vegetation 2 - 5 m <0.5 m<@\@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1053:20x rbUUIIIIAA:..,,,,      aaa_VJE12E?a#AMSA x Y`V@ F .(FY< k@ APIS.AA202BayfieldAlnus incana Swamp ShrublandCEGL002466 - Populus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestAlnus incana Swamp ShrublandCEGL002381Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach20215NAD834.5mJ. Marr, B. Dunlap1Gentle1 degreeNHigh slopebeachPalustrineU@Zplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m 1 - 2 m <0.5 m <0.5 m(@\W@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:41 AMxidXXLLLLLLB88-"""" gaaU~````VJE76Ex?a4%A SA x YX@  .( (Y<( @APIS.AA201Ashlandxwet meadow mixed herbaceous mapclassCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestMixed Herbaceous Wet Meadow (map class)HWMAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island15NAD8310.6mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelbeaver pondPalustrineSaturated@Zplant stemsPerennialGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@\mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak10:46xukk`UI>>'lffZ aaa_VJE72M/a$ASA x Y`@ <.F( Yl@APIS.AA200AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Cat Island15NAD836.3mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplandF@Zplant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mKeys easily to CEGL002457@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1064:30xrpppjh^ uuiiiiaa[QL@;55"""""aaa_VJE12E0?l ta a$A=SA x Y ^@ 2. (2Y  @APIS.AA208AshlandxPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL005125 - Pinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589Pinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125APIS Long Island15NAD835.4mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplandL@ Zplant stemsEvergreenNeedle-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m|@\ [Drawing]mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:18W is sedge-cattail swale.xWUU:31'qfYYMMMMEE?50$`Taaa_VJE72Eya0-%A@SA x Y ]@ F.( YP @ APIS.AA207AshlandCalamagrostis canadensis-Phalaris arundinacea Herbaceous VegetationWet meadow mixed herbaceous mapclassCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174Mixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD836.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLowslopeflatPalustrineSaturated@ Zplant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:55xVQQQQQQQQQG==2''''yrnnnnnnQKKF____VJE72Mx?az#ASA x Yc@ F.PY  @APIS.AA206BayfieldxEroding Clay Bank Sparse VegetationCEGL002584 - Eroding Clay Bank Sparse VegetationAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Eroding Clay Bank Sparse VegetationCEGL002584APIS mainland15NAD836.4mJ. Marr, M. SmithSomewhat steep25 degreesW280LowslopebankUplandf@ Zplant stemsMixed evergreen - cold-deciduousMixedShrubland15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m8@\ [Drawing]mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon710:25xfaJJ>>>>>>4** vvccccc]VRRRRRR<66*bbb`VJE72E?az$ASA x Y _@ <.Z(<Y< l@APIS.AA205AshlandxTsuga canadensis - (Betula alleghaniensis) ForestTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APIS Bear Island15NAD835.0mC. Groebner, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplandDryplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mD@U@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:11birch-maple-cedarx_]]JDB8l__NNNNFF@61% aaa_VJE12E0 a$A@[SA x Y`c@ F .<((2Y l@APIS.AA212BayfieldxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Sand Island15NAD8310.3mJ. Marr, M. SmithVariableMidslopeflatUpland@ Zplant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@UAcer saccharum probably a "P"mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon74:38xdbbb\ZSsffZZZZRRLBB8888%%%%%bbb`VJE12E0?a3$ASA x Y^@ 2. Y(l@ APIS.AA211BayfieldxAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS York Island15NAD836.1mJ. Marr, K. HiserGentle2 degreesVariableMidslopelow duneUpland@ Zplant stemsPerennialGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10612:53xJHHHA?5xxnddZOGG44444.'###### bbb`VJE12E8?a^$AeSA x Y_@ <.2F(Y<l@APIS.AA210BayfieldxPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISSand Point RoadMeyers Beach15NAD833.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mN@\@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:15ash, birch, pine, cedarxLJJ1*(!_RR888800* THbbb`VJEw2Ea.$A SA x YZ@ (.F l@APIS.AA209AshlandxPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125APISStockton Island15NAD832.5mJ. MarrGentle5 degreesWMidslopeslopeUplandDense and diverse shrub layerplant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@U]@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus83:45N is Ammophila dune community.xpk__SSSSSSI?5*~~uuuuuohddddddGAAAA5aaa_VJE12E8W T aoa| $A@SA x Y@c@  <.2(Yl@APIS.AA217BayfieldxFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island15NAD8310.3mJ. Marr, M. SmithGentle2 degreesS180LowslopedrainagePalustrineSaturated:@Zplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m|@a}@ XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon712:20x~|u72&&zpki^VVCCCCC<5111111bbb`VJE12M0?a#ASA x Yc@ K .PYl@APIS.AA216BayfieldxThuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island15NAD839.5mJ. Marr, M. SmithGentle2 degreesS166MidslopeflatUpland@Zplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m`@amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon7N/Ax5333.,%tgg[[[[SSMC><1)) bbb`VJE12E0?ap$ASA x Y _@ F .(2< Yl@APIS.AA215AshlandxAbies balsamea - Betula papyrifera / Diervilla lonicera ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APIS Bear Island15NAD836mC. Groebner, K. HiserGentle2 degreesEflatUpland@@Zplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@a@ XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:38Paper birch-maplexXVVC=;1naaUUUUMMGGGE:22      aaa_VJE129E0a#%A@SA x Y ]@   F.( Y l@ APIS.AA214AshlandxEroding Clay Bank Sparse VegetationEroding Clay Bank Sparse VegetationCEGL002584APISMichigan Island15NAD836.8mJ. Marr, K. HiserSteep35 degreesNMidslopebankUplandp@Zplant stemsCold-deciduousBroad-leavedSparse vegetation 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@ao@ XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1056:27xuubTD77++++##aaa_VJE12Ey?a$A%SA x Ye@ d.Z  Y2l@ APIS.AA213AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD836mJ. Grochowski, T. GostomskiGentle1 degreeNE35MidslopehillslopeUpland]@Zplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@UmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus43:12CEGL002457xfddXRPG wwwwoodZVRH@@#####aaa_VJE12E0LVAL2(  j  t`P`Equal amount of red and white pine.Pinus resinosa dominant in canopy with Betula papyrifers in subcanopyNo peat layer; dry with black raspberry understory.Moist area with Acer rubrum and Betula alleghaniensis and Alnus incana more dominant. Second choice since close in dominance would be Acer rubrum dominant.Best fit with birch and aspen and balsam fir in understory.Easy to key; fits class well (except that Chamaedaphne is high % cover and dwarf-shrubs are the dominant layer - this would lead key to CEGL005228 but too much tree/shrub cover.)Betula papyrifera with lots of Abies in subcanopy; less than 25% relative cover northern hardwoods; keys better to CEGL002468 but fits description of CEGL002466 better.Random point is in small area of mixed (within canopy) forest. It is a small headwater drain area.Keys out to 2 vegetation association types. Primary choice doesn't have the oak influence, second choice requires >40% but since sugar maple and red oak had equal percent cover it would fit.cedar stand dotted throughout polygon pushes it into cedar AA; best fit is cedar with >25% deciduousSome areas with less Tsuga canadensis.Hemlock dominant with red maple in canopy. Very little shrub layer due to hemlock and cedar.Keys to 5277 or 5228 (Chamaedaphne-dominated shrubland); seemed to best fit CEGL005277.Even with substantial amount of Pinus strobus. Best fit is Picea mariana as dominant.Mostly red maple and mix of other trees with shrub Alnus incana dominant.decided on the vegetation association due to the sparse vegetation; floating-leaved aquatics. For second choice could be CEGL002562Greater than 25% relative cover Fraxinus therefore CEGL002105.Coniferous type (<25% deciduous relative cover).CEGL002474 is best fit with birch in canopy and fir; hemlock and cedar in understory.Overall vegetation less than 10% although parts of polygon west of AA point have much greater than 10%. m (a8h$ASA x Y ^@ (<.(PY Zl@APIS.AA221AshlandxChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APIS Long Island15NAD832.8mJ. Marr, K. HiserFlatn/aFlat (n/a)n/aMidslopebasinPalustrineSaturatedH@Zplant stemsEvergreenBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1052:14N of polygon - jack pine (woodland)x<:: qfYYMMMB66/%   pdaaa_VJE72MxaV$ASA x Y\@ 2 (.22 Pdl@APIS.AA220AshlandxPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD834.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUpland!Well-drained; minimal blowdown.plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@a@ XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:05maple, birch, cedar, hemlock, pinex_ZNNBBBBBB8.$snb]WW?????92......    aaa_VJE12Ea$ASA x Y\@ ((.22 22l@APIS.AA219AshlandxAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISStockton Island15NAD832.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@ak@ XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:30balsam fir, birch, hemlock, maplexGB66******  ymh\WQQ999993,(((((( aaa_VJE12Ea$ASA x YZ@ Z .( Yk@APIS.AA218Ashlandinterdunal wetlandCEGL002562 - Nymphaea odorata - Nuphar lutea (ssp. pumila, ssp. variegata) Herbaceous VegetationInterdunal wetlandNymphaea odorata - Nuphar lutea (ssp. pumila, ssp. variegata) Herbaceous VegetationCEGL002562APISStockton Island15NAD838.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelbeaver pondLacustrinePermanently flooded@Zplant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 m@amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:35xSNNNBBBBBBB8888888!~~~~~xqmmmmmmPJJ>s____VJE62M@F?Z ura$ASA x YZ@ < .P(Y( @APIS.AA226AshlandxFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APISStockton Island15NAD834.4mJ. MarrGentle2 degreesNELow leveldrainageUpland@Zplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m Black ash swamp - keys easily.-@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus62:50SE=cedar-black ash forest; NW=paper birchxhff;53*zoogYI<<0000((aaaaa_VJE12EpaF%ASA x YX@ P .FY( l@APIS.AA225AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISOuter Island15NAD837.5mJ. Marr, B. DunlapGentle1 degreeVariableHigh slopeflatUplandl@Zplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mL@ aN@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:20Mixed vegetation community throughout.x`ZXQxxlllldd^RRH>66"""""aaa_VJE12Eah$ASA x Y_@ F .P(Y l@APIS.AA224AshlandxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APIS Oak Island15NAD837.1mC. Groebner, N. MurphySteep35 degreesSWMidslopehillslopeUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mHemlock with birch and cedar.t@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:00birch, maplex~@;//llllddYOOK?88     aaa_VJE12Ea1%AOSA x Y[@ Z. ( Ydk@APIS.AA223AshlandChamaedaphne calyculata/Carex oligosperma/Sphagnum spp. Poor Fen Dwarf-shrublandChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277APISOuter Island15NAD836.2mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLowslopeflatPalustrine=@Zplant stemsEvergreenBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mV@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:50x_]]]WUN zuid^\DDDDD>7333333____VJE12Ey?a#A@LSA x Y_@ (2.P( YPl@ APIS.AA222BayfieldxTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISSand Point RoadMeyers Beach15NAD835.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drained; some blowdown.plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m <0.5 m@a@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:30hemlock, birch, cedarxzxq3.""    toc^XX@@@@@:3/////bbb`VJEq2E Ta #ASA x Ya@ P .2< Yl@APIS.AA230BayfieldxBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002466 - Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APIS15NAD835mU. GafvertModerate10 degreesNWhillslopeUplandplant stemsCold-deciduousBroad-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ a1@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoLumix63:43x}qqeeeeeee[[PE9..&PDbbb`VJE29?a $A@ISA x Y W@ F.<2Y k@APIS.AA229BayfieldAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002461 - Quercus rubra - Acer saccharum ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Quercus rubra - Acer saccharum ForestCEGL002461APIS Sand Island22915NAD836.9mC. Groebner, N. Murphy1Gentle1 degreeVariableHigh slopeflatUplandg@eplant stems, peatCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m|@ amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak3:15 PMxtoooccccccYOOD9.## }}xxxx_YYM&````VJE76E/a$A@ SA x Y]@ 2.<<<2Yk@APIS.AA228BayfieldThuja occidentalis-Betula allegheniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISSand Point Road15NAD835.0mC. Groebner, N. Murphy1Gentle5 degreesE98MidslopeslopeUplandN@eplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m@ amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:50x:8881/(reeYYYYQQJ@<:/'%     ````VJE12E?a$ASA x Y]@ 2 (.P(Y  @APIS.AA227AshlandTsuga canadensis - (Betula allegheniensis) ForestCEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Tsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISIronwood Island15NAD833.1mC. Groebner, N. Murphy1FlatFlat (n/a)High levelflatUpland@Znext to cedar and birchplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:40x~tti^SHH@9 e__S ____VJE72Ű?LVALK w S 0 -  & QbN}H Rpoorly drained; beaver dame area creating pools, downed logs and snags; perimetepoorly drained; beaver dame area creating pools, downed logs and snags; perimeter of polygon has red maple, yellow birch, hemlock; forest is closing in on wetlandlow herb cover; standing dead paper birch and yellow birch; lots of Abies about 5m tall; dense Thuja shrub layer; part of polygon is steep, east-facing slopehillslope; well-drained; hemlock stand on western boundary; herb layer mostly sugar maple seedlings and litter/duffmoist depression; lots of sphagnum; very dense, dark polygonwet meadow with scattered shrubs and trees; standing dead trees; lots of downed wood; beaver-disturbed site (chewed stumps, beaver dam); few pools of standing water; fairly dry site now; no sphagnum seenwet saturated soil with open standing water; some areas flooded, others dry; standing dead trees, old overgrown beaver dampoorly drained site; moist soil; recent Abies downed treesabou 2m above Lake Superior; level sandstone ledge and large boulders; plants grow in rock crevices; shallow rock pools of water; lots of lichens (crustose mostly) on bedrockmesic forest; open understory; sparse herb layer, mostly litter/duff on ground;well-drained; some blowdown; sparse herbaceous layer due to dense canopy and tall shrubs; quite a few Acer saccharum seedlingseroding clay bank; minimal blowdown; clay hills with some vegetation; rocky shorelinesoil saturated; many hummocks; standing dead trees; hollows with Calla and Maianthemum; canopy cover about 15%Many blowdowns, snags, mesic. A few red maple in herb layer and Trientalisdry, ground uneven with pockets and hummockspoorly drained; wet pockets between alder; pond on north edge of polygon with grass medowabout 25m wide sandy beach dominated by Ammophila; bracken fern occurs farther west near forest edgepoorly drained; a few cattails at southern margin <5% with Calla and Comarum more standing water; mostly leatherleaf understory with alder abovemoderately drained; area looks like drought has changed this thin strip from wetland along waters edge to dry sp. along pine barren margin; sphagnum mat is dry with graminoidswell-drained; some blowdown; lots of balsam fir blowdown; <5% Sorbus decora along cliffs edge; sparse understory, some ash sugar maple seedlingsWetland to south of plot looks dry with small slow-moving stream only water present. Lakeshore about 75 m north of plot. Betula papyrifera snags and downed trees; openings with yew and areas of dense Abies (tall shrub/subcanopy size).Mesic woods with beaver wetland 20 m or so to SW that has standing water with graminoids, Iris, etc. Polygon APIS.247 has low herbaceous cover; evidence of past logging (sawn-off stumps); beaver-chewed stumps in APIS.247.Hummocky, mesic upland. Deciduous forest, no disturbances.Fairly dry site as far as cedar-black ash swamps go; downed trees; standing dead Abies.Low-lying area, probably ephemerally wet.well-drained; shrub layer is sparse but herbaceous stratum dense with mostly bracken fern and melampyrum; other spp. <5% eachWet pockets with grass and alder.Moderately drained; some blowdown.Next to ravine on west side. Mesic. Some blowdowns.Slope is from GPS point down to stream to east - most of the polygon is variable slope/aspect, basically flat undulating; polygon narrow lining Lake SuperiorMesic woods with peaty soil. Evidence of blowdown. Sparse herbaceous stratum. Dense Taxus canadensis.hill slope; old and recent blowdown mostly cedar and sprunce, dense canopy so mostly litter/duff; many pole-sized paper birch, yellow birch, and red maple in understory, large old-growth maple, some Rubus parviflorus in openings, cedar stands have very little herbaceous stratum, mostly litter/duff, deciduous stands more vegetationI  a/%ASA x Y Y@ <.((<Y2 l@ APIS.AA234AshlandxAlnus incana Swamp ShrublandCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestAlnus incana Swamp ShrublandCEGL002381Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island15NAD837.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatPalustrine$@eplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m6@a2@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:55CEGL002457xrmaaUUUUUUKAA6++~zzzzzz`ZZNaaa_VJE72Eya#A4SA x Y@`@ < .(Z<Y2l@APIS.AA233BayfieldxPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD831mC. GroebnerSomewhat steep18 degreesW270MidslopehillslopeUpland5@eplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mv@a@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:54maple-birchxvpng)$       yojh\LL?????;4000000bbb`VJE12Ea$A:SA x Y^@ (.(2(l@APIS.AA232AshlandxPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD832.5mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatPalustrineSaturatedWetland; no standing water.plant stemsEvergreenNeedle-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m0.5 - 1 md@a9@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10510:05xz<7++ uuoe`TOII?????92......    aaa_VJE12M?a$ASA x Y\@ <.22Y( @APIS.AA231AshlandxPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002474 - Abies balsamea - Betula papyrifera / Diervilla lonicera ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Abies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APISStockton Island15NAD836.6mJ. Marr, K. HiserVery steep51 degreesEHigh levelflatUpland@eplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mP@ aH@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1066:43xxmme^<//####  \Paaa_VJE72E0? ; a`#%ASA x Y[@ F.F F<l@APIS.AA238AshlandxPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APISOuter Island15NAD833.6mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsEvergreenNeedle-leavedForest15 - 20 m 5 - 10 m 1 - 2 m <0.5 m <0.5 m <0.5 mF@a2@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:05CEGL005228xigg[USL hhhh``ZNI=822       aaa_VJE12Ea`$A@tSA x YZ@ F.<( P @APIS.AA237AshlandPinus resinosa/Vaccinium spp. ForestCEGL002520 - Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestPinus resinosa / Vaccinium spp. ForestCEGL002443Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestCEGL002520APISStockton Island15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUpland@eplant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@amjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:00xwwwwwwwmcXMB77/ ~xxl ____VJE72E?aJ#A@SA x Y@X@  <.2<YPl@APIS.AA236BayfieldxPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD836.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatPalustrineSaturated#@eplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mKeyed out easily.@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:50CEGL002468 - aspen, paper birchxC>22  upd_YYAAAAA;4000000bbb`VJE12Ma$A=SA x Y@^@ .(25% relative cover of deciduous trees in polygon but difficult to call. I put down CEGL002598 as primary name (although this type is not supposed to have any or little white pine - what percent does this translate to?). Maybe CEGL002590 type? (Great Lakes White Pine)This 1/2 hectare might not be representative of the larger part of polygon. After walking to next point, there is more deciduous spp. So could then change assoc to CEGL005044.Small drainage channel but still well-drained; species do not vary from the surrounding areas. I could see how this could be mapped differently due to small ravine, however the species composition does not vary significantly. Herbaceous layer is slightly different.NOTE: Individual taxa covers are RELATIVE.Fits this class by Pinus strobus and >25% Betula papyrifera in canopy and Tsuga and Abies present but low cover %. Note: Populus and Corylus absentPopulus grandidentata, not Populus tremuloides, is present.Deciduous tree (and black ash) greater than 25% of canopy cover so keys to CEGL005165.No Fraxinus and Cornus canadensis.Bog mat with leatherleaf and Myrica gale) ?a$ASA x YW@ P.<<Yl@APIS.AA242AshlandxPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISBasswood Island15NAD839.8mC. Groebner, N. Murphy, B. DunlapGentle1 degreeFlat (n/a)n/aHigh slopeflatUplandMesic deciduous forest.plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mv@h[@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:16Cold-deciduous throughout.xRMAA5555555++  |rjjGGGGGA:666666aaa_VJE12Ea$A@ SA x Y]@ < .F Y<<l@APIS.AA241BayfieldxThuja occidentalis - Fraxinus nigra ForestThuja occidentalis - Fraxinus nigra ForestCEGL005165APIS mainland15NAD836.8mJ. MarrGentle2 degreesNEMidslopeflatUplandY@eplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m <0.5 m <0.5 m@hLots of Equisetum sylvaticum.mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:15E is Alnus incana thicket.xSQQ5.,%uumfD77++++##bbb`VJE12E0a$ASA x Ye@ 2 .( YZl@APIS.AA240AshlandxAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISStockton Island15NAD834mJ. Grochowski, T. GostomskiGentle1 degreeW255Basin floordepressionPalustrineIntermittently flooded+@eplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 mD@hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus512:22x}?:::......$zmhf\TT777773,(((((( aaa_VJE12Mp?aN&%ASA x Y[@  P. ( < Pl@APIS.AA239AshlandxChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISOuter Island15NAD832.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated!Poorly drained, standing water.plant stemsEvergreenBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 mP@h@XmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak68:45paper birch, Pinus strobusxID88,,,,,,"wwqfaUPJJ22222,%!!!!!!aaa_VJE12MLVAL%1 z L  Z )  ? + iK1iLarge white-cedar tip-up - took out 4 treesLarge white-cedar tip-up - took out 4 trees - blowdown took 5% of white-cedar component.photos taken about 10m north of GPS point; species listed are for wetter part of polygonMore herbaceous stratum with road and open areas between cedar stands, not as dense in overstory, herbaceous stratum spp. listed some <5%no cover values for individual species recorded; unable to determine scientific names for oak fern and shield fern listed on plot sheetdominat herbaceous spp rubus pubescens fraximus nigra dominat canopy with ash seedlings in understorysouth of dock is slope below lighthouse that recently was part of revegetation project (invasives there include Barbarea vulgaris)Within sight of lighthouse buildings. Polygon south of and parallel to AA pt 380 is mixed forest of Pinus banksiana, Quercus, Pinus resinosa, and P. strobus.viewed from boat about 11 m west and 158 m north of pointnarrow band around bogmat - assessed alder next to forest; a few short trees birch and pine but<5%; alder on sphagnum mat with leatherleaf; all alder and leather leaf narrow band surrounding bog matOne large red maple; one white-cedarphysiognomy closer to woodland than forest (<60%)North of polygon is narrow polygon with dense shrub layer (Acer spicatum, Rubus parviflorus, Corylus); Betula papyrifera dominant tree spp.no cover values for individual species recorded; uncertain of some taxa because only common names were givenall herbaceous spp <5%; some Thuja and Tsuga but <5%cedar trees have striped bark; new cedar blowdowns; foliage is eaten in canopyHerbaceous stratum sparse, all species <5%. Some old and new blowdowns.Deschampsia flexuosa along beachside <5%; dead and dying paper birch standing; juniper only along beachside; hawkweed in open areaspaper birch canopy with cedar in subcanopy; sparse understory due to dense cedar, yew and Acer spicatum; more birch and cedar adjacentunderstory dense with Impatiens capensis; alder dominantAlso Maianthemum, Cornus canadensis, Abies (H-size). Lots of Abies (S1-size). Point is just E of trail past campsites. Forest physiognomic class checked even though technically a woodland (less than 60% canopy cover).GPS is right on beaver dam/dike (dominated by Rubus)no cover values for individual species recorded; uncertain of some taxa because only common names were givenUTM coordinates taken on top edge of very steep bank; actual AA point at bottom of bankheights below canopy not recordedno cover values for individual species recordedno cover for Acer spicatum/tall-shrub layer recordedSparganium is main plant in one of the wet pockets. Other veg to west (Tsuga-Betula alleghaniensis) and south (Abies-Thuja-Acer rubrum).Pinus strobus about 15%; canopy cover about 25%looked mostly southwest and west of AA pointassessed polygon to edge of cliff as much as could be seen from ridgetopAA point on line between 2 polygons; assessment of 1/2 ha east of pointSmall polygon (1/2 ha?). Carex and Iris in wetland to south; W of polygon is hemlock stand; N is forest of large (20 m) hemlock, white pine, birch, and red maple.Very little herbaceous stratum due to dense Vaccinium and Juniperus.I walked from AA point to Se end of polygon; some Pinus strobus and Tsuga canadensis were emergent (large dbh up to 25"). Emergent cover class estimated.Defoliation taking place by caterpillars. Cedar has stripped bark. Very sparse understory due to dense hemlock and cedar canopy. Cedar and hemlock seedlings.species covers were not calculated in the usual way (total cover) but rather as relative cover within each stratumHerbaceous stratum mostly leaf litter. Populus grandidentata are tallest trees in canopy.@ Va|$A9SA x Y _@ 2.Z2(Yl@APIS.AA246AshlandxTsuga canadensis - (Betula alleghaniensis) ForestCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APIS Bear Island15NAD834mC. Groebner, K. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplandDryplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m^@h@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:11Mix -Acer, Beltula, Oak, hemlock, CedarxxxxxxxnddYNC880)vppd"aaa_VJE72E0a$ASA x Yg@  2.F Y(l@APIS.AA245AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS15NAD834mA. Kirschbaum, A. DerixGentle5 degreesN360Channel bedchannelPalustrineIntermittently floodedplant stemsCold-deciduousBroad-leavedForest20 - 35 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ht@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoPanasonic71:44xOMMMGE:uuuuu]QQH;64)!!aaa_VJE2 ?a$AzSA x Ye@ <.FY(l@APIS.AA244AshlandxAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS15NAD836mA. Derix, A. KirschbaumGentle5 degreesN360High slopeflatUpland<@ eplant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 mT@hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoPanasonic51:03x~naaUUUUMMG;64)!!aaa_VJE2E_?a$ASA x Y^@ <.F(Y( @APIS.AA243AshlandxPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002590 - Pinus strobus - Tsuga canadensis Great Lakes ForestPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479Pinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590APISStockton Island15NAD837.0mK. HiserFlatn/aFlat (n/a)n/aMidslopeflatUplandDryplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m&@hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1062:10xtooocccccccYYNC8--%rll`+aaa_VJE72E0o?[ a7%ASA x Y[@ 2(.<(Y k@APIS.AA250AshlandPopulus tremuloides-Betula papyrifera(Abies balsamea, Picea glauca)ForestCEGL002463 - Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463APISOuter Island15NAD832.4mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUpland@ eplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m"@ hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:00birchx zoog`>11%%%% VJ____VJE72Ea:C%A@@SA x YX@ P .((Y l@APIS.AA249AshlandxAbies balsamea - Betula papyrifera / Diervilla lonicera ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APISOuter Island15NAD833.3mJ. Marr, B. DunlapGentle1 degreeFlat (n/a)High slopeflatUpland@ eplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m @ h@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:56See Commentsx_]]OIG@vvjjjjbb\PPD:22      aaa_VJE12Eae$ASA x Y ^@ P.( F @ APIS.AA248AshlandxPinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002441 - Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestPinus banksiana - (Pinus resinosa) - Quercus ellipsoidalis / Carex pensylvanica ForestCEGL002478Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002441APIS Long Island15NAD832.1mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh levelflatUplandWell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 1 - 2 m <0.5 m <0.5 m <0.5 mV@ hF@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:50birch, oak, aspen.x533ttleC66RFaaa_VJE72Ea4%ASA x YY@ P < Y l@APIS.AA247AshlandxTsuga canadensis - (Betula alleghaniensis) ForestCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISOuter Island15NAD838.2mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflat@ eplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@h@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak4:08SW=Graminoids, otherwise mixed conifer/deciduousx zznnnnnnnddYNC8-%vppd"aaa_VJE72A0o[ Ia$ASA x Y^@ <.FY2 @APIS.AA255AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISStockton Island73315NAD837.1mK. HiserFlatFlat (n/a)MidslopeflatUpland.@eplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mf@hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1064:09xJEEE9999999//$xttooooRLL@_____VJE76E0?a$ASA x YZ@ F.(FYPk@ APIS.AA254AshlandAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APISStockton Island15NAD838.2mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrine[@eplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:30x||qqfXH;;////## }}____VJE12Ey?av$A@SA x YZ@ F.( <k@ APIS.AA253AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISStockton Island01015NAD837.0mJ. MarrGentle5 degreesSW220LowslopebeachUplandf@e@plant stemsPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m easy to keymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus612:20x mbRE9----%% ______VJE168?a,k$AܿSA x Y ^@ F.(2Fdk@ APIS.AA252AshlandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD837.1mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturated@eplant stemsCold-deciduousBroad-leavedShrubland 1 - 2 m0.5 - 1 m <0.5 m <0.5 m <0.5 m alder and leatherleaf dominantmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:00x2000*(!~~~~seUHH<<<1%%______VJE12M?a$AaSA x YZ@ P.(<2Fk@ APIS.AA251AshlandWet meadow mixed herbaceous maplclassMixed Herbaceous Wet Meadow (map class)HWMAPISStockton Island15NAD834.0mC. Groebner, N. Murphy1Gentle5 degreesELowslopeflatPalustrine@ eplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@ hmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:00x uuuuj\L??3333''! ____VJE12E?kn K9a$A>9999 `````VJE76M0y?a%ASA x Y@]@ ( . YP k@ APIS.AA263Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island05815NAD833.1mJ. Marr, K. HiserFlatFlat (n/a)Midslopebeaver pondPalustrineSaturated|@eplant stemsPerennial herbGraminoidHerbaceous vegetation15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 mB@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1051:05x#!!!shXKK???4((____VJE16M?a $A@SA x Y@c@ < .(2 Yk@APIS.AA262BayfieldCEGL002105 - Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island01715NAD838.0mJ. Marr, M. SmithGentle2 degreesSW210LowslopedrainagePalustrine<@e10% plant stems, 10% sphagnumCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon711:40xvvk`UJJB4${uui `````VJE76E?a/$AhSA x Y^@ P.(Yk@APIS.AA261BayfieldSandstone Bedrock Great Lakes Shore Sparse VegetationCEGL002507APIS York Island07915NAD834.2mJ. Marr, K. HiserFlatFlat (n/a)MidslopeledgeUpland@eplant stemsMixed evergreen - cold-deciduousMixedSparse vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10511:39xvkkkkXQ/""``````VJE16Ex?LVAL > 8 LDnothing else fits - difficult to assess clay slope versus vegetated slope; looks like 50:50 so called it CEGL002584; rocky shoreline - need classification with clay slope and more than 10% coverkeys out easily; toss up between primary and seconday associations; hemlock and sugar maple close in dominance; could fall into <25% deciduousconiferous forest; hemlock dominant; <25% deciduous; emergent white pine; secondary is CEGL002590 although white pine is not dominantclassification depends on amount of Hudsonia; if sufficient = CEGL004024; seems to be at least 30% but grass cover >25% so doesn't key"dry" beaver meadow dominated by Calamagrostis candensis; keys to CEGL005174CEGL002257 - Scirpus cyperinus dominant meadows; if polygon is tree stringer it is CEGL002467bigtooth aspen dominant in canopy so gave primary CEGL002468 but still enough oak for CEGL002461beaver-influenced wetland; leatherleaf and Carex seem to be codominant; primary is CEGL002562 (Brasenia mostly); secondary is CEGL005277 of CEGL002257no dominant species so chose wet meadow (beaver evidence)AA point fell on bedrock lakeshore; main part of polygon is paper birch-dominated forest with lots of Abies in subcanopy (CEGL002466); secondary is mixed (CEGL002474)best fit but more than 25% hardwoods; next choice with hemlock in canopy would be CEGL005044<25% deciduous, therefore coniferous type; keys to CEGL002456/CEGL002449difficult choice as equal amounts of Tsuga and oak in canopy but more Tsuga in subcanopy; primary went with oak as dominant, Tsuga subcanopy; secondary understory sparse due to dense Tsuga in subcanopyshrub cover >25% but alder not present so doesn't key well; lots of Scirpus so put into CEGL002257 as primary even though no Carex noted; secondary put as mixed although mixed type does not include shrub species (only emergent, graminoid and herb species)CEGL002282 present in 1/2-ha areadeciduous type; ash about 25% cover so could key to either CEGL002071 or CEGL002105; canopy cover less than forest (60%) u a$-%A5SA x Y Y@  <. (Y<k@APIS.AA270Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD833.6mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineIntermittently flooded@rplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mr@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:15x zl\OOCCC+____VJE12M?a8+%ASA x YY@ <.( Y2k@ APIS.AA269Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD834.8mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatPalustrine@eplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m 1 - 2 m <0.5 mmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak10:35xynnnncUE88,,,,  ____VJE12Ex/a$ASA x Y`@ F .F22 Y k@APIS.AA268AshlandCEGL002474 - Abies balsamea - Betula papyrifera / Diervilla lonicera ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Abies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APIS Cat IslandWP51715NAD839.4mJ. MarrGentle2 degreesNELowslopelake terraceUpland@eD@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mL@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus510:20xgbbbVVVVVVLBB7,!~zzssss[UUI _____VJE763?a$$ASA x Y`@ <(.Z(<Y2k@APIS.AA267AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APIS Oak Island15NAD834.6mC. Groebner, N. MurphyGentle5 degreesWMidslopeslopeUplandu@eplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:40xa\\\PPPPPPPFF;0% }yyyyyya[[O _____VJE72E?a#ASA x Yc@]K.P2 Y<k@APIS.AA266BayfieldCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island04815NAD839.5mJ. Marr, M. Smith2Gentle2 degreesS159Basin floordepressionPalustrine>@eplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon74:02xSNNNBBBBBB8...#  ~~~~~xqmmhhhhOII=`````VJE76E0?LVALC  ( D  } b+cbeach area with bank of shrubs and trees; westside of polygon has rock shore with moss; ridgetopbeach area with bank of shrubs and trees; westside of polygon has rock shore with moss; ridgetop is white pine and hemlock; equal amounts of sand beach with grass and bank having alder and birchdry; sparse herb layer due to dense balsam fir understorypoorly drained pond; standing water; open water with snags surrounded by leatherleaf and sphagnum mat; beaver dam to west; trail crosses to pond; margin of wetland has <5% Cornus canadensis and Clintonia borealis; Gaultheria hispidula found on sphagnum mat but <5%; no herb layer below leatherleaf; no dominant species; Ranunculus acris and Calamagrostis candensis on trailpoint is on old beaver dam; much wetter than adjacent APIS.648; channels of standing water; standing dead trees; no sphagnum; whole polygon is seasonally flooded (still flooded on 16 September 2008)dry upland; southern end of polygon on Lake Superior lakeshore; recent canopy (cedar) blowdown; old moss-covered log; canopy gaps; sparse herb coverwell-drained; some blowdown; all herbs <5% cover; sparse understorywell-drained; sparse understory, mostly litter/duff; all species <5% each; hemlock dominant with cedar; several red oak <5%; <25% deciduous except along polygon margindry upland; many windblown trees fallenextensive evidence of past blowdown; sparse understory; old 2-track runs through polygon; canopy may have included Populus grandidentatamesic; trail through polygon; borders alder thicket and beach; old fire ring made of rocks <5%; mix of grasses all <5%, Poa, etc.dry upland; standing dead old yellow birch; many blowdowns in area; recently snapped off (Abies and Thuja) about 2-3m from ground; canopy gaps with shrub maples; canopy about 15m; giant Sorbus decora alive but dying (about 13" dbh); Taxus leaves chewed off (caterpillars?)eroding clay bank; polygon is narrow strip of bank along shoreline looking NE; hawkweed and pussytoes <5% found on bare clay slopesmoderately drained; some open areas without alder and leatherleafsmall Fraxinus <5m in polygon; large Fraxinus nigra to the northwet, mesic; grasses and sedges in open pockets with Alnus incanaevidence of blowdown; sparse understory due to hemlock canopy; point is one western edge; looked east and NEwell-drained, downslope to WSW; GPS point is on level ground (plateau?); about 5m to SW it slopes down to stream at about 32 degrees; blowdowns including many large old paper birch; herbs and shrubs under canopy opening, otherwise many areas without ground coversandy substrate, very well-draineddry sand dune; mostly Ammophila or sand; all other haraceous species <5%GPS point (and most of polygon) is on dry ground; channel to east probably represents another polygon; standing dead trees; scattered tall-shrub yellow birch and red maple; water-filled channel runs through polygon with Carex utriculata mostlywell-drained; polygon on steep slope; mostly litter/duff on forest floor due to dense canopy of hemlockseasonally flooded; lots of sphagnum; scattered trees 5-10m tallpoorly drained; standing water; many beaver lanes to pond; AA point on narrow polygon of trees and grasses; some water in sedge meadow; tree margin also wet; Scirpus dominant, sphagnum around margin with blueberrywell-drained; sparse understory with mostly maple saplings and seedlingsAA point is at edge of pond in leatherleaf/Carex wetland; old beaver dam? north of pointpoorly drained; medium-sized stream present; flowing stream through polygon; one red oak in bottomland along stream; rest of oak are on ridgeline; Hieracium lines streambank on sunny side{ Mad$ASA x Y_@ 2(.ZYk@APIS.AA275AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APIS Oak Island15NAD839.9mC. Groebner, N. MurphySomewhat steep25 degreesSMidslopeslopeUplandi@rplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m"hemlock dominant with some birchmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:00x|qff^W5(( ______VJE12E?a $A@SA x Yc@ A.PY(k@APIS.AA274BayfieldAlnus incana Swamp ShrublandCEGL002381APIS Sand Island05315NAD833.4mJ. Marr, M. SmithFlatFlat (n/a)LowslopedepressionPalustrineSeasonally floodedB@r20% plant stems, 45% sphagnumCold-deciduousBroad-leavedShrubland15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon7xynncUE&&~``````VJE16M0a$A>SA x Y\@  P. YFk@APIS.AA273AshlandCEGL002467 - Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467APISStockton Island15NAD835.7mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturated@rplant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@ pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:15xth]]F;+)_____VJE72M?aք$ASA x Y_@ <.F<Yk@APIS.AA272AshlandCEGL002461 - Quercus rubra - Acer saccharum ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Quercus rubra - Acer saccharum ForestCEGL002461APIS Oak Island15NAD839.1mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandJ@r$@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@ pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:10x{yyyrpi*%%%~~rrllTTTTTNGCCCCCC+%%_____VJE72Ő?a$ASA x Y\@ Z .( 2Y< @ APIS.AA271AshlandCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD836.8mJ. Marr, K. HiserFlatFlat (n/a)pondPalustrinePermanently floodedZ@rplant stemsPerennial herbBroad leaf herbaceousSparse vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 m,@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1054:26x|wwwkkkkkkaWWLAAAA.tnnb _____VJE72)M@x?S H %a$ASA x YX@ Z.P Y k@APIS.AA280AshlandCEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Tsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISBasswood Island28015NAD838.0mC. Groebner, N. Murphy, B. DunlapGentle2 degreesVariableHigh slopeflatn@ rplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:36xHCCC7777777--" eeeee_XTTOOOO2,, _____VJE76A?a$ASA x Y`\@ P < Yk@APIS.AA279AshlandCEGL002590 - Pinus strobus - Tsuga canadensis Great Lakes ForestTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598Pinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590APISStockton Island - Quarry Bay15NAD839.6mJ. Marr, K. HiserFlatFlat (n/a)High levelridgeUpland@ rplant stemsEvergreenNeedle-leavedForest20 - 35 m20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m @ pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1065:11xzxn/*** {{uubbbbb\UQQQQQQ'!!_____VJE72E0?aB$ASA x YZ@ F .(Y2k@ APIS.AA278AshlandCEGL004024 - Hudsonia tomentosa Dune Dwarf-shrubland [Provisional]Ammophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098Hudsonia tomentosa Dune Dwarf-shrubland [Provisional]CEGL004024APISStockton Island02315NAD835.4mJ. MarrGentle2 degreesWHigh levelflatUpland$@rplant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m0.5 - 1 m <0.5 m <0.5 m @ pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus712:10x}t5000$$$$$$vvvvvpiee````C==1_____VJE76Ea?a!%ATSA x Y[@  2.( Zk@APIS.AA277AshlandAmmophila brevilgulata-(Schizachyirum scoparium) Herbaceous VegetationAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISOuter Island15NAD832.9mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh leveldune (undifferentiated)UplandJ@rplant stemsPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 mmostly beachgrassmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:15xpnnnhf_ qe`TOIG/////)"____VJE12E?a$ASA x Y\@ F.( Y<k@ APIS.AA276AshlandCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174APISStockton Island15NAD832.6mJ. Marr, K. HiserFlatFlat (n/a)Midslopebeaver pondPalustrineSaturated@rplant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1054:57x mbREE999.""  ______VJE12Mpx?| Ca$ASA x Y`@ P .F(Y l@APIS.AA285AshlandThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Cat Island51515NAD8310.0mJ. MarrGentle1 degreeNELowslopeflatstanding dead yellow birchplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus59:50x  |qqib@33      ______VJE16A0?a .%ASA x Y ]@  .Yl@APIS.AA284AshlandEroding Clay Bank Sparse VegetationEroding Clay Bank Sparse VegetationCEGL002584APISMichigan Island15NAD836.0mC. Groebner, N. Murphy1Steep35 degreesNMidslopebankUpland@rplant stemsMixed evergreen - cold-deciduousMixedWoodland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@pmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak61:10sprucex  ||rkI<<0000((" ____VJE12EaX$ASA x YZ@ F. 2(( (l@APIS.AA283AshlandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APISStockton Island15NAD830.5mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatC@ rplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m alder and leatherleaf dominatemjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:00x97770.'wllaSC66******$  ______VJE12A?a#ASA x Y@X@  F.<2 Y(l@APIS.AA282BayfieldPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD834.2mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandB@ rplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m easy to keymjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak61:05x ||tmK>>2222**$  ``````VJE12E?aN#ACSA x Y@X@ (.<<< Y<l@APIS.AA281BayfieldCEGL002466 - Populus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD8310.0mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandB@ rplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m more fir and spruce than aspenmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak61:35x[[[[[[[QQF;0%%keeY`````VJE72E?:LVALzT\ b P ( ,lkeys to CEGL002474 although Abies <50% in uppermost canopy and lacks paper birch, therefore doesn't fit too well; description does include yellow birch which is present hereCEGL002257 dominant vegetation os Scripus cyperinuswith red pine and Vaccinium dominant went with CEGL002443 but could easily be considered pine barrens CEGL002589keys to CEGL005271 if chose 45B (>25% tree cover), tree cover is about 25%; if <25%, keys to CEGL005277, but trees should be <10% in that typeprimary - more paper birch; secondary - balsam fir may be codominant with birch due to numbers in subcanopy and tall shrubshrub-dominated; description for CEGL002471 seems to fit fairly well although may not be enough Larix; secondary name is shrub community occurring in shoreline situation (CEGL005227)bigtooth aspen dominant with maple and oak subcanopysparse canopy allowed for CEGL005271 (polygon has 30% Picea mariana in canopy and 20% emergent white pine)beaver pond and dam looking north into habitat polygon; did not do Picea and Larix on pond margin - assessed water gullyassessed bach and hillside equal amounts; west with beach habitat as primary but could easily be paper birch-dominated with alderpaper birch dominant with dense balsam fir understoryunusual site; Leersia dominant grass; Scripus cyperinus about 1/2 the cover of Leersia; doesn't key well because not dominated by Calamagrostis or Carexmixed type; keys to CEGL002450; (yellow birch not noted on form); description fits wellhemlock dominant; several white pines by <5% covercanopy dominated by paper birch and aspen (Abies in subcanopy); similar to CEGL002467 although shrub layer not well-developedfits for pine with birch understory but doesn't take into account oak; second choice would be CEGL002479 which includes oaksabout 30% canopy cover ("woodland"); lots of downed trees so cover was probably higher in past; CEGL002450 best fit although much less canopy cover35% cover conifer (cedar), therefore mixed type; keys to CEGL002450V  naX$A4SA x Y\@ <.PY l@APIS.AA290AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISStockton Island15NAD832.1mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUpland@rplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m <0.5 md@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:45xvk``XQ/""______VJE12E?a<$ASA x Y`@ 2.F(2Y @APIS.AA289AshlandCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Cat Island76215NAD835.1mK. HiserFlatFlat (n/a)MidslopeflatUpland)@rplant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m0.5 - 1 measy to key - fits wellmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10610:41x}>999  zzttjjjjjd]YYTTTT<66*_____VJE76E0?aJ%A@dSA x YX@ F .< Y(l@APIS.AA288AshlandCEGL002467 - Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467APISOuter Island28815NAD834.8mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflatUpland@rplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:27xwwwwwwmcccXMBB:,w _____VJE76E?a$ASA x Y`^@  7.<( 2l@APIS.AA287BayfieldCEGL002479 - Pinus strobus - Populus tremuloides / Corylus cornuta ForestPinus strobus / Acer spicatum - Corylus cornuta ForestCEGL002445Pinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APISSand River wetland area15NAD834mC. GroebnerGentle5 degreesW250MidslopebankUpland@r50% plant stems, 5% mossesMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:30x\WWWKKKKKKKA7,!  sssssohdddddd?99-`````VJE72E?af$A@SA x Y]@ 2.((Yl@APIS.AA286AshlandThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISIronwood Island06515NAD836.4mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland@rplant stemsMixed evergreen - cold-deciduousMixedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m&@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10610:32x   tii_X6))______VJE16E0?L <at$A@SA x Y _@ <.P2<(Y @APIS.AA295AshlandCEGL002474 - Abies balsamea - Betula papyrifera / Diervilla lonicera ForestBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463Abies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APIS Bear Island15NAD834mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatUpland;@rplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 mj@vJ@jmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1062:02xRMAA5555555++  tttttpieeeeeeLFF:_____VJE72E0?a4%AsSA x Y Y@  F.(Y2 @APIS.AA294Ashlandwet meadow mixed herbaceous mapclassCEGL005277 - Chamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228Chamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277APISOuter Island15NAD839.8mC. Groebner, N. MurphyFlatFlat (n/a)LowslopepondPalustrinePermanently floodedw@rplant stemsEvergreenBroad-leavedShrubland10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m best fit - no dominant speciesmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:20x ttii^PE88,,,  >2____VJE72My?a#ASA x Y`c@  2.( YZl@APIS.AA293Bayfieldwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPIS Sand Island02915NAD834.5mJ. Marr, M. SmithFlatFlat (n/a)Basin floordepressionPalustrineSeasonally flooded@rplant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 m0@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon711:40x{p`SSGGG3''````VJE16Mp?aJ$ASA x Ya@ (.<((PYl@APIS.AA292AshlandThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISOtter Island78415NAD838.0mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland@r1@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@vI@jmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10611:40x! {ppha?2& ______VJE160?a;%A@SA x YX@ 2 (.<<Yl@ APIS.AA291AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISOuter Island15NAD834.6mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandE@rbog located to southplant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mhemlock dominantmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:45x{pphYNA  ______VJE120?  Ea$ASA x Y@c@ F .<( Y( @APIS.AA300BayfieldCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Sand Island01915NAD838.7mM. Smith, J. MarrFlatFlat (n/a)MidslopedrainagePalustrineSaturated@z.@10% plant stems, 10% sphagnumCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mno Fraxinus seenmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon71:10xyyyyyyoeeZOD991#{{vvvv]WWK`````VJE760?av$ASA x Y`]@ Z .(Yl@APIS.AA299AshlandSandstone Bedrock Great Lakes Shore Sparse VegetationCEGL002507APISStockton Island06415NAD832.6mJ. Marr, K. HiserGentle1 degreeWStep in slopeledgeUpland@z@plant stemsCold-deciduousBroad-leavedSparse vegetation 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m easy to keymjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10512:19x vvcUE8,    ______VJE16y?a$ASA x Y\@ << YFl@APIS.AA298AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD8311.2mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflkatPalustrineSaturatedS@zplant stemsEvergreenNeedle-leavedForest20 - 35 m15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ v.@jmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1062:22x2000*(wo`UHH<<<1%%______VJE12M0?a6%AbSA x Y[@ F.( Y2l@ APIS.AA297Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD837.8mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLowslopebeaver pondPalustrineSaturated@zplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m <0.5 m@ vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoNDNDNDxqaTTHHH=11$ ____VJE12MF?a&$A@hSA x YZ@ 2.Y2l@APIS.AA296BayfieldCEGL002463 - Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098Betula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463APISLittle Sand Bay15NAD833.2mC. GroebnerSomewhat steep20 degreesNLowslopeslopeUpland@rplant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:22xidddXXXXXXNDD9."{wwwwwwZTTH`````VJE72E?LVALh , 8 b _Zf+VJvery wet; tussocks of Carex exilis and Cladium mariscoides in standing water (ankle to knee dvery wet; tussocks of Carex exilis and Cladium mariscoides in standing water (ankle to knee deep); small scattered "islands" of sphagnum, dwarf leatherleaf, Myrica gale, and pitcher plantsdry upland; lots of sugar maple regeneration; deciduous canopy near 20m highwell-drained; minimal blowdown; hilly area down to shore with steep ravines; polygon does not go to shoreline on top of ridges; leaves are being eatendry; point of land by water has a small pocket of moss with snowberry, blueberry and black spruce trees; no herb layer under balsam fir except fir and cedar seedlingsdry; open area of blowdowns with some sphagnum; grasses and sedges <5%well-drained; some blowdown; very narrow band of quaking aspen/birch with Thuja and hardwoods and spruce; with open pockets of small spruce, Acer spicatum and bracken fernmoderately drained; minor blowdown; herbaceous stratum sparse due to dense shrub layer all listed <5%steeply sloping upland toward Lake Superior (about 40m)rotting moss-covered stumps and logs; sparse ground coverstream from extensive wetland to SE flows through polygon near AA point into Lake Superior; very narrow polygon (2-3m of sand beach); 4-6 zone of Ammophila which is wetland edge with Alnus, Fraxinus; one patch of Phalaris arundinacea on beachsmall stream runs east-west; blowdown; evidence of old beaver activity; Carex along streamvery shaded site; dense Abies 2-10m tall; rotten moss-covered logs, some recently snapped off Abies so more canopy cover in past; yellow birch about 25% absolute coverWet; with pockets of standing water and muck as well as areas (most of the polygon) that are currently dry - mounds. Except in wet pockets, ground very uneven.poorly drained, standing water; Other herbaceous spp. <5% are Onoclea sensibilis, Lycopus uniflorus; saturated standing water in beaver-dammed area; mostly Scripus, some Potamogeton in standing water <5%; all trees equal 5% but <5% eachback of dunegrass beach; dry, well-drained; opening in polygon dominated by Hudsonia tomentosa with Cladina, Spiraea alba and lots of exotic Rumex acetosella (GPS 686826, 5200370)well-drained; some blowdown; blowdown of spruce so pockets of sparse herbaceous stratumsphagnum nearly 100% cover; ericaceous shrubs dominant with scattered trees (canopy/subcanopy) of Pinus strobus and Picea mariana; many trees close to 5m heightwell-drained; major blowdown; borders trail with Ranunculus acris and Hieracium aurantiacum; trail is west boundary; pockets of sedges and grasses <5%; no herb layer, only sparse tree seedlingswell-drained; some blowdown; Populus dominant in canopy with fair amount of red oak; subcanopy of maples; shrub layer a mix; herb layer 1/2 litter/duffshrub-dominated wetland; sphagnum abundant; conifers (<60%)well-drained; converging multiple slopes; a few Tsuga and saplings on northern boundary; mostly litter/duff on forest floorwet, downstream of dam; channel runs through corridor, with patchy flooded areas; paper birch snags; no sphagnum seenwell-drained; minimal blowdown; not very dense shrub layer; ferns <5% including oak fern and lady fernpoorly drained; standing water; some blowdown; wet with some sphagnum; dense understory, herbaceous stratumnarrow drainage with lots of sphagnum; wet depressions; flooded in spring; dark line on photo is opening with Acer spicatum and Corylus?dry bedrock with quick run-off; gentle slope; level exposed bedrock in stages lowering to water's edge; total vegetation about 10% coversoil mostly saturated; no standing water; carpet of sphagnum; emergent white pinepoorly drained, standing water; canopy species all equal 5% cover; herbaceous stratum of Impatiens capensis and Iris versicolor <5% and marsh marigold9 a$ASA x Y`\@ (<.(<2P @APIS.AA305AshlandCEGL002471 - Larix laricina / Alnus incana ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271Larix laricina / Alnus incana ForestCEGL002471APISStockton Island - Quarry Bay15NAD833.2mJ. Marr, K. HiserFlatFlat (n/a)Low levelwetlandPalustrineSaturated=@zT@plant stemsEvergreenNeedle-leavedWoodland 5 - 10 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m <0.5 ml@ vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1054:04xJEEE999999/%yyss`````ZSOOOOOO%_____VJE720?a$A@MSA x Y`@ <.F< Yk@APIS.AA304AshlandPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS Oak Island15NAD833.1mC. Groebner, N. MurphyModerate8 degreesSWMidslopeslopeUpland}@znext to sugar maple - oakplant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mh@ vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak69:45x4222,*#wjC7777//(______VJE12Ő?a$A@SA x Y\@ 2(.( YP k@ APIS.AA303AshlandCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISStockton Island15NAD83J. Marr, K. HiserFlatFlat (n/a)Channel bedbeaver pondPalustrineIntermittently floodedw@zplant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 2 - 5 m <0.5 m <0.5 mmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10511:54x$"""obbVVV>22%  ______VJE12MP?a$ASA x Y_@ <.P< Y< @APIS.AA302BayfieldCEGL002467 - Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467APIS Meyers Beach - Sand Point Road15NAD838.9mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandh@z'@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m mostly red maple, birch, aspenmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:00x    ti^SSKD" |vvj`````VJE72Ű?a$ASA x YZ@ <.(F(Y<k@APIS.AA301AshlandAlnus incana Swamp ShrublandAlnus incana Swamp ShrublandCEGL002381APISStockton Island15NAD834.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrineTemporarily floodedm@zplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 malder dominantmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:00x,***$"{m]PPDDD/## }}____VJE12My?8A  /Pa $ASA x YZ@ (.( k@APIS.AA310AshlandPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125APISStockton Island02415NAD835.3mJ. MarrGentle3 degreesNWMidslopeslopeUpland@ zplant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 mkeys out easilymjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus712:50xDBBB;90zk`SSGGGG??8..*______VJE16E?a$A SA x YZ@ F.<<<k@APIS.AA309AshlandPinus resinosa/Vaccinium spp. ForestCEGL002589 - Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestPinus resinosa / Vaccinium spp. ForestCEGL002443Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APISStockton Island15NAD833.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUplandY@ zplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:40xhcccWWWWWWMC9.#  |uqqqqqqTNNB____VJE72E?a#ASA x Yc@t.3(____VJE12Ax@?a%AhSA x Y@]@  F.(YF @ APIS.AA311AshlandCarex(ROSTRATA, UTRICULATA)-Carex laucstris-(Carex vesicaria)Herbaceous VegetationWet meadow mixed herbaceous mapclassCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257Mixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD837.8mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@zplant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 1 - 2 m <0.5 mf@vmjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:50balsam furx{vvvjjjjjjj``UUUJJ3(  smmh?3____VJE72MatLVAL 2 <4Ddominant is paper birch with some Tsuga and subcanpoy has balsam fir and cedarhemlock, birch and maple canopy with a little oakclay hill with mostly Prunus and paper birch tall and short shrubs <5%; a few Picea glauca; Herbaceous stratum is a mix of speciespaper birch dominant with some oak; sugar maple in subcanopy dominantsparse understory, mostly litter/duff; more hemlock than cedar; Pinus strobus emergentalder thicket with leatherleaf and Myrica galekeys to CEGL002466/CEGL002468 but fits former better; lots of Abies in subcanopy and tall-shrub layersbest fit with all the oak; type does not allow for hemlock so a bit confusing as to what to call this; not enough hemlock for CEGL005044paper birch-dominated canopy; conifers in subcanopy; primary type is mixed; secondary is deciduousgraminoid-dominated; very little leatherleaf so doesn't key to CEGL005228; keys best to CEGL005229; sphagnum <20%; standing water presentdeciduous forest; did not seem quite enough Tsuga to make mixed type; not enough Quercus for CEGL002461; secondary type is CEGL005044best fit with aspen, birch, oak with hemlock in understory and subcanopyvery small polygon with dense balsam fir subcanopy and shrub layer; canopy made up of birch; best fit would be CEGL002474; NE point in polygon has a small pocket of moss with snowberry, blueberry and black sprucemix of Acer, Betula and Tsuga with subcanopy of Thuja and Abiesbest fit with aspen dominant; the two cedar associations do not work with the variety of species; does not allow for Pinus or Populusdifficult to key, could not find good fit with Picea mariana and Pinus sp. with dense bog shrub species; settled for CEGL002447 but could fit into pine barrens CEGL005125no hemlock; few supercanopy Pinus strobus; dominants are Picea glauca and Abies>25% deciduous therefore mixed type; keys to CEGL002450; recently downed Abies and Thuja; enough conifers in past to be CEGL002449?chose this AA wet with hemlock dominant@ & {az$ASA x Y _@ 2.P<<>2222**$ :.____VJE72E0Qa#A_SA x Yd@ P F<   @APIS.AA317BayfieldCEGL002479 - Pinus strobus - Populus tremuloides / Corylus cornuta ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Pinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APIS15NAD835mU. GafvertSomewhat steep40%NWside slopeUpland9@zplant stemsEvergreenNeedle-leavedForest20 - 35 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@~1@ jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoLumix612:16x}}}vtm/*wwwsn^^RRRRRNGCCCCCCC==1`````VJE29E0?a#ASA x Yc@ F.P Wa$A@SA x Y`\@ F .F(Y< `k@APIS.AA325AshlandTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island - Quarry Bay15NAD837.4mJ. Marr, K. HiserFlatFlat (n/a)High levelflatUpland@Quercus rubra nearbyplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mnarrow polygonmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1062;43xLJJJDB8h[9----%%______VJE120?a $A@WSA x YZ@ (.( Y<`k@ APIS.AA324AshlandCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCarex lasiocarpa - (Carex rostrata) - Equisetum fluviatile Herbaceous VegetationCEGL005229Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island01915NAD833.3mJ. MarrFlatFlat (n/a)Low levelflatPalustrineSaturated@z20% plant stems, 20% sphagnumPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m@ ~mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus89:27E - Dune communityxsnnnbbbbbbXNNCCCCC,!pjj^_____VJE76MP`a@$AaSA x Y`@ <.F2(Y`k@APIS.AA323AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISOtter Island77315NAD837.6mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUplandN@zplant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m @~mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10612:20xNIII======3)){tppkkkkQKK?_____VJE76E0?a$ASA x Y\@ <(.PY2`k@APIS.AA322AshlandPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISStockton Island15NAD833.5mC. Groebner, N. MurphyModerate12 degreesEMidslopeslopeUpland@zplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m@~mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:30birch, maplex)'' }vTGG;;;;33,""   ______VJE12EaT|$A@7SA x Y _@ 2.2F @APIS.AA321AshlandCEGL002479 - Pinus strobus - Populus tremuloides / Corylus cornuta ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Pinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APIS Bear Island15NAD834mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatUpland@zplant stemsEvergreenNeedle-leavedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@~mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F106NDBetula papyrifera - Thuja occidentalisxz<777++++++!! nnnnnjc______F@@4_____VJE72E0LVAL}" + K B  } So\,|Ihummock-hollow; very shrubby; >5% Alnus; hollows with Mehummock-hollow; very shrubby; >5% Alnus; hollows with Menyanthes and Comarum palustre; probably very wet in springdry-mesic area above shoreline at mouth of Sand Riverdry; many fallen trees (blowdowns)some patches of saturated soil (mud); mostly dry, but soils are poorly drained; seasonally floodedMesic woods with small stream running through plot; Open understory. Pockets of standing water. All herbaceous species equal 5% and other 5% is remainder of non-dominant spp.well-drained; drainage running west to the lake through polygon approx. 6 feet deep with blowdown, interrupted fern in ravines (drainage), other than the ferns all herbaceous spp. <5% each, some Lycopodium obscurum and Lycopodium annotinumdry cliff (bank) with hemlock saplings; no herb layer, several birch and hemlock seedlings, rest is rocks, soil and litter/duffborders hiking trail to south and shoreline to north; sparse understory due to balsam fir; slope to lake with fir and blowdownswell-drained; some blowdown; tall, old-growth oak and Tsugashallow channel runs N-S through point, currently with no standing water (somewhat muddy); otherwise dry; cedar along west side had stripped bark; a mix of shorter Picea, Acer and Thuja canopy with alder understory; very sparse herb layer due to balsam fir, alder and cedarbeaver pond; most of polygon is dry but there is open water and muck at SE end and a channel (currently dry) running along the west side and through the middle; old beaver dam banks around SE end; tall shrubs around edges onlyall herb layer <5%; very sparse understory due to Tsuga canopydry; point near lake at bottom of steep sand/clay SW-facing slope; tall-shrub cedar and paper birch; 50% with no coverwell-drained; minimal blowdown; dense vegetation in shrub and herb layers; moist soil but not any standing watermucky depressions with Calla palustris; hummocky; paper birch in 1/2-ha polygon; large red maple near AA pointwell-drained; some Quercus rubra in subcanopy <5%, all but Lycopodium <5% in understory, herbaceous stratum; fairly dense, balsam fir in understory in pocketspermanently flooded with dry hummocks throughout; standing dead trees, mostly cedar; scattered paper birch and red maplewell-drained; some blowdown; blowdown recent (balsam fir); open areas of understory have herbaceous species; areas of dense balsam fir have litter/duff under Taxus canadensis; wetland to eastwell-drained; minimal blowdown; a large Quercus rubra but <5% of canopy; sparse herb layer due to balsam fir and hemlockeroding clay bank; beach is small rocks; more tall shrubs on south end of polygonwell-drained; some blowdown (birch); large oak but more paper birch and sugar maple in subcanopydry; soft ground (conifer litter and aerated soil); bluff at north edge of polygonwell-drained; all but Canada mayflower and wintergreen are <5%; herbaceous stratum and Sorbus decora <5%poorly to moderately drained; very wet/standing water around alder thicket; herb layer sparse due to black raspberrygently rolling upland; sparse aspen, paper birch (<50% canopy cover); blowdown; some balsam fir in understorypart of 1/2-ha area around AA point is steep vegetated clay bank and flat forested bluff top; steep-sided ravine just west of point; standing dea paper birch; originally part of polygon was sparsely vegetated clay bank but now has dense tree/shrub cover; lots of recent blowdownswell-drained; lone Pinus strobus in subcanopy; sparse understory due to oak leaves and balsam fir shrub layerabove lakeshore; cliffs on east side; no herb layer; very shady; moss-covered logs/stumpsrolling upland, well-drained; brook to WSW about 60m with steep slope down to it; lots of blowdowns including canopy-sized cedars - ta6p$A|SA x Y@^@ F.(P$ASA x Y\@ 2(.P(Y<k@APIS.AA333AshlandPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISStockton Island15NAD832mC. Groebner, N. MurphyGentle5 degreesWHigh slopeflatUplandb@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@~looking NW into polygonmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:30birch, maple, pinexECC/)' vvn`PCC7777//)______VJE12Ea%ASA x Y^@ <.<2(>6'______VJE16A0?ax:%ASA x Y[@ (2<(  k@APIS.AA331AshlandTsuga canadensis-Betula alleghaniensis Saturated ForestTsuga canadensis - Betula alleghaniensis Saturated ForestCEGL005003APISOuter Island15NAD838.7mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrinej@plant stemsMixed evergreen - cold-deciduousMixedForest35 - 50 m15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m <0.5 m@~mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:10hemlock, cedarxhffVPNG }ppddddXXRFA50*( ____VJE12E$G I :a+%A@SA x Y ]@ <#. F Y<< @ APIS.AA339AshlandCEGL002071? - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestAlnus incana Swamp ShrublandCEGL002381Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISMichigan Island04315NAD833.5mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturatedp@30% plant stems, 5% sphagnumCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m <0.5 m <0.5 mZ@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1062:59xZUUUIIIIII?555*tttttngcc^^^^A;;/_____VJE76M0?a $A@SA x Y]@ 2(.P<2Y< @APIS.AA338BayfieldPopulus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS15NAD834.1mC. Groebner, N. Murphy1FlatFlat (n/a)High levelhighlandUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:20aspen, maple, birch, Balsam firx-++ vvngE88,,,,$$l`````VJE2Ea$A@qSA x Y\@  (.( Y<k@ APIS.AA337AshlandCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISStockton Island15NAD8310.7mJ. Marr, K. HiserFlatFlat (n/a)Basin floorbeaver pondPalustrinePermanently floodedz@ plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m6@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:48Surrounding - Acer rubrum, Betula papyriferaxcaa3,* sffZZZE99,  ______VJE12Mpa%A@ISA x Y ]@ <.<((PY2 @APIS.AA336AshlandPopulus tremuloides-Betula papyifera(Abies balsamea, Picea glauca)ForestCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISMichigan Island15NAD838.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m0.5 - 1 m@~mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:30spruce, birch, maplex|qqib@33'''' UI____VJE72EHLVALv    FVTvsparse Tsuga canopy (25%); primary vegetation keys to CEGL005044 (secondary is CEGL002457 with 10% cover Tsuga)canopy is dominated by paper birch with hemlock and fir in subcanopy (CEGL002463); with all the birch in canopy, primary seemed best fit but second choice had all species in association even though conifer was in the subcanopy (could be considered dominant)deciduous canopy; lots of cedar snags (canopy); most/all living cedar in subcanopy; keys to CEGL002071 (no mention of cedar in description); if cedar emphasized could be CEGL002456 (probably was before die-off)Betula papyrifera and Acer rubrum in sub-canopy approaching canopy size; could take either 21A or 21B in key; difficult to place type, description of 2445 seems to fi best; however, polygon is on sandscape, not bedrock as states in key. 2444 is on sandscape but has <5% shrubs (this polygon had lots); is >25% hardwoods, keys to 2479 (tertiary name!).Sugar maple is dominant in canopy; stand has large-dbh aspen and birchmostly paper birch with red maple and balsam fir subcanopy/understoryhard to assess cliff but mostly large boulders along shoreline with hemlock, paper birch; more than 1% vegetation but best fitbest fit with paper birch and no Populus2 pockets of hemlock but more oak in canopy; if oak taken out of canopy (due to narrow polygon), then would be CEGL005044difficult to decide with a fair amount of red maple but best fit would be cedar and alder; shoreline influence made choice a problemnorth end is wet meadow of mixed herbs and SE end is dominated by Scirpus; polygon is about 50:50dominant birch is paper birch; a few white pine and red pine so may be CEGL002590 is a better fit2 types: steep bank (mix of herbs/shrubs) and Populus - Betula forest at top of slope; forest type keyed to CEGL002468cEGL002105 <25% cedar in subcanopy; if more cedar then would be CEGL005165appears to be CEGL002381 with scattered treesmostly aspen with maple and dense balsam fir subcanopy and understory} + aP$AoSA x Y^@ ( 2.( YZk@APIS.AA343Ashlandwet meadow mixed herbaceous mapclassCEGL002257 - Carex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISStockton Island73815NAD836.8mK. HiserFlatFlat (n/a)Basin floorbeaver pondPalustrineSemipermanently flooded@plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m 1 - 2 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:48Acer rubrum (dom), Abies, Betula papyriferaxvvvkk__H=-  t____VJE76MPa.z$AlSA x YX@ F .F2(Yk@APIS.AA342AshlandCEGL002590 - Pinus strobus - Tsuga canadensis Great Lakes ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Pinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590APISBasswood Island34215NAD835.6mC. Groebner, N. Murphy, B. DunlapGentle5 degreesWInterfluve/SummitridgeUpland@@E@ plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@trail runs through plotmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:06Mixed evergreen - deciduous throughout.x[OOOOOOOEE:/$ iiiiic\XXSSSS600$_____VJE76Űa$A@SA x Y\@ Z .2 Y2k@APIS.AA341AshlandCEGL002466 - Populus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISStockton Island15NAD832.5mJ. Marr, K. HiserSteep100%SWLowslopebankUplandx@plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1057:50 PMxb]]]QQQQQQQGGG<1&&}wwk_____VJE72E?a%ASA x Y@]@ <.F(F k@APIS.AA340AshlandCEGL005165 - Thuja occidentalis - Fraxinus nigra ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105Thuja occidentalis - Fraxinus nigra ForestCEGL005165APISMichigan Island15NAD837.7mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatUplandr@next to cedar and paper birchplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:25birch, maple, balsam fir, sprucexvqqqeeeeee[QF;0% zzbbbbb\UQQQQQQ4.."_____VJE72Ű 4a2$ASA x Y]@ (2.P((Y  @APIS.AA348BayfieldBetula papyrifer/Diervilla lonicera - (Abies balsamea) ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISMeyers Beach - Ridge Road15NAD833.8mC. Groebner, N. Murphy1FlatFlat (n/a)High levelflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak65:00birch, aspen, maple, Balsam firx|qeZZRK)=1````VJE72Ea!$A)SA x Y^@ .  Yk@ APIS.AA347BayfieldSandstone Great Lakes Shore Cliff Sparse VegetationCEGL002503APISLittle Sand Bay15NAD836mC. GroebnerSteep40NW320High slopecliffUpland@plant stemsMixed evergreen - cold-deciduousMixedSparse vegetation10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:38Pinus strobus, Betula papyrifera, Tsuga canadensisx/--{oddQJ(``````VJE12Ea<$AMSA x Y X@ .2< Y k@ APIS.AA346AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISManitou Island15NAD838mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mP@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak4:002457xPKKK???????55*  {{{{{wpllllllPJJ>_____VJE72Eoa$ASA x Y`\@ (2.P< (YFk@APIS.AA345AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestQuercus rubra - Acer saccharum ForestCEGL002461Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD839.8mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland=@n@ plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:30maple, birchx~w9444((((((({{ccccc]VRRRRRR5//#_____VJE72Űarz$ASA x Y_@ <.F2< Y( k@APIS.AA344AshlandThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456APIS Bear Island74115NAD836.4mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturated@$@ plant stemsEvergreenNeedle-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10611:44E - Pinus strobus, Pinus resinosaxKII&{laTH<<<1%%  ______VJE16ͰLLVALfdheavy defoliation of both birch speciescabin in woods adjacent to polygonAA point on/near trail; road and parking area in polygontrail NE of polygon; road to northlots of standing dead cedar; logged in past Ua:$ASA x Y^@ P . ( Y @g@ APIS.AA357BayfieldAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS York Island07815NAD832.9mJ. Marr, K. HiserFlatFlat (n/a)LowslopebeachUplanddry, sandy beach; low slopeplant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m <0.5 m@&mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:07x"    {p`SS****""``````VJE16E?aj(%ASA x Y[@ 7.22Y< @APIS.AA356AshlandCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISOuter Island15NAD834.4mC. Groebner, N. MurphyGentle5 degreesELow levelbeachUplandwell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m best fit@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:25birch, aspenx}rg\QQIB u"_____VJE72Ea$ASA x Y`^@ P.( (2YP@g@APIS.AA355BayfieldLarix laricina / Alnus incana ForestCEGL002471APISmainland - Sand River38715NAD835.7mJ. MarrGentle1 degreeNWLow levelflatPalustrinet@30% plant stems, 50% sphagnumEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 mkeys to CEGL004271 easilymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus711:50x%###~sg\\RC8    ``````VJE16E?a"$ASA x Y`^@ 2-.22@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:00N - shoreline; S - Alder thicket; W - sandxECC}[NB6666..(  ``````VJE120ar$A@SA x Y _@ 2.<<<(Y@g@APIS.AA353AshlandCEGL002474 - Abies balsamea - Betula papyrifera / Diervilla lonicera ForestBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463Abies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APIS Bear Island15NAD834mC. Groebner, K. Hiser1Gentle3 degreesWMidslopeslopeUpland$@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1069:25paper birch - cedarxXSGG;;;;;;;11&tttttpieeeeeeLFF:_____VJE72E0LVALP . ^|~"dominant oak stand with sugar maple understory>25% cover deciduous trees so keys to CEGL005044; could also be CEGL002598 if deciduous cover was overestimated (actually <25%)mix of Thuja and Betula all.; more Thujareally doesn't fit CEGL002584 because vegetation cover >10% and substrate of eroding bank seems pretty sandy, not clayvery narrow polygon; jack pine "woodland" with some pines in canopy; keys to CEGL005125 (because total tree canopy cover is less than 60%); does have some oaksome dwarf leatherleaf and Myrica gale (graminoid-dominated community) but CEGL005228 best fit (but too little leatherleaf to key to this type)Mostly ash, only one large white-cedarpolygon is long, runs along shore west side; mostly paper birch and balsam fir but pockets of Alnus incana and Cornus sericea along shoreline; steep bank to ridge and rest of polygon; on top of ridge mostly vegetated (bank)canopy cover of red pine seems higher than black spruce but not enough to be dominant conifer, therefore keys to CEGL002447 (13B not 13A)beach dune area dominated by grasses; a few sedge spp. by Alnus incana pocket on northern enddoesn't key easily (e.g., Abies greater than 50% in canopy) but fits CEGL002474 fairly wellno dominant species emerges when computing coverassessed area on slope to wetlands sparse understory due to dense Abies balsamea and Taxus canadensisdense shrub layer without sphagnum, just peat; Ilex and alder on border to west; 5% standing water; <5% Typha, Phalaris northern end of polygonin correct polygon? if so, it was deciduous swamp forest (Acer rubrum and Betula all.) with lots of Thuja in subcanopy; keys more or less to CEGL002071; however, no mention of Thujacedar is dominant with birch and Acer spicatum understorypolygon at this point is a mix of hardwoods and conifers; all short with black raspberry understory with some grass spp.; best fit since mostly birch and mapleLVAL[Y . :  j +  "yrc  eroding clay bank; sparsely vegetated eroding clay hill, dry no seeps; tall shrubs dominant eroding clay bank; sparsely vegetated eroding clay hill, dry no seeps; tall shrubs dominant Thuja occdentalis; cobble tracks on shoreline; ridgeline Sorbus decora, cedar and paper birchwell-drained; Pinus resinosa dominant with Vaccinium in understorywell-drained; all herbaceous <5% due to dense sugar maple seedlings and Taxus understorylow diversity; much less shrub cover compared to other pine forests in vicinity; tambolo trail goes through polygon; well-drained soilRich mesic woods, old road overgrown with vegetation through polygon with some standing water, old blowdown with recent tops of balsam fir broken offwell-drained; polygon consists of short Populus, Pinus and Betula trees with Myrica gale and Alnus in shrub layer; herbaceous layer mostly Poa spp.ravine slope/backslope; moist (late summer); point is within 10m of drain in steep ravinenear small opening (about 30x30m) with pond (Lemna minor and Scirpus cyperinus on edges); most of 1/2-ha area around point is Populus grandidentata forest with sparse herb layer; lots of Acer saccharum in subcanopy and much regeneration in shrub and herb layerspoorly drained; standing water; minimal blowdown; beaver dam is trail to east and south creating pondsmesic woods; lots of downed trees and branches; footpath about 15m to north; very narrow polygon; herb cover sparse; moss-covered rotting logs; several emergent Tsuga above canopy layermoderately well-drained; dominant herbaceous species Rubus pubescens; Fraxinus nigra dominat canopy with ash seedlings in understorywell-drained; multiple merging hillslopes; cedar tree shredded bank; ravine through polygon; small amount of running water; sparse understory; most listed spp. <5% cover except ferns; hemlock seedlings scattered throughout polygondry; cedar trees are shredded (bark); blowdowns; sparse understory due to dense hemlock/cedar, fir subcanopy and shrub layersome blowdowns; dense understory with ferns and mountain maple; <5% Canada yewunvegetated sand beach with lake to NE; steep clay?/sandy slope between bach and high level; areas of slope lacking vegetation (eroded); other areas with dense herbaceous cover with shrub-sized trees (Betula spp.)clay bank about 3m high; about 80%of polygon is clay bank and 10% sand beach; about 50% sandstone ledges; seastack presentchannel along eastern edge of polygon with Brasenia schreberiMesic woods with pools of stagnant water scattered infrequently.point on narrow sandy beach at Lake Superior edge; beach widens and much more Ammophila, etc. commondry, rolling hills with various aspects (basically sloping west); drainage through polygon to lake; no herbaceous stratum due to dense balsam fir; some yew but mostly litter/duff; some open pockets with Acer spicatumsilts over clay; blowdowns, moss-covered logs; openings with Corylus cornutawetland, no standing water; tall shrubs and subcanopy trees only at edge; patches dominated by Ledumwell-drained; young vegetation recently planted; sandy area with small trees and shrubs; a pocket of Hieracium aurantiacum (<5%); beach duneupland cedar; very few seedlings/saplingslots of downed trees; no ground cover; dry, many hummocks from treefalls and underlying roots; point is 20-30m east of shore (bedrock/large boulders, about 3m above lakepoorly drained; beaver dams; some standing water; nothing flowing; mostly Calamagrostis, but not dominant; drier areas away from water, Hieracium aurantiacumsoil saturated (in depressions) with many hummocks/mounds; no standing water; opening of Alnus incana just east of pointwell-drained; other herbaceous spp. <5%; some grass spp. <5%dry; many recently downed trees (from storm?)Evidence of blowdown. Bog adjacent to plot.mesic woods with some large downed trees; old stumps (large-dbh Tsuga?) V pa$ASA x Y\@ (.<( Y22@g@APIS.AA362AshlandAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISStockton Island15NAD838mJ. Marr, K. HiserFlatFlat (n/a)Low levelflatPalustrineSaturatedz@20% plant stems, 10% sphagnumCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 mj@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1062:46x qaBB666+______VJE12M0?a $%ASA x Y[@ F.< Y( @APIS.AA361AshlandCEGL002589 - Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestPinus strobus / Vaccinium spp. ForestCEGL002444Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APISOuter Island15NAD832mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland>@plant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mmix of red and white pinesmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:00CEGL005228x}v8333       ttnnVVVVVRKGGGGGG-''_____VJE72Ea@t$ASA x Y_@ (.<<(Y<@g@APIS.AA360AshlandThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Bear Island74715NAD836.3mC. Groebner, K. HiserModerate8 degreesNMidslopeslopeUpland/@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mr@P@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1062:25Betula and Acer spp.xxmbbZL<//####  ______VJE16E0aP$A`SA x Y W@ P .(22Y@g@APIS.AA359BayfieldAcer rubrum - Fraxinus sp. - Betula papyrifera/Cornus canadensis ForestAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APIS Sand Island35915NAD8310.0mC. Groebner, N. Murphy, B. Dunlap1GentleVariableHigh slopeflatPalustrineSaturated-@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mKeys out easily.I@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak71:51 PMS - Larixxy;6**       znndd\Z777770)%%    ````VJE16Ma ,%ANSA x YX@ P .P2Y@g@APIS.AA358AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISOuter Island35815NAD8310.6mJ. Marr, B. DunlapGentle2 degreesVariableHigh slopeflatUplandI@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:49Mixed conifer-deciduous throughoutxidddXXXXXXNDD9.# |uqqllllRLL@_____VJE76E"  a#A_SA x Ya@ F .F Yk@APIS.AA367BayfieldCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS15NAD836mU. GafvertGentle5%NWHigh slopeslopeUpland+@plant stemsEvergreenNeedle-leavedForest15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 mn@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoLumix52:20xNLLLFD=||||ttmaa]YQQEEEEEA:666666600$`````VJE2E0?a.$A@VSA x Y^@ <.<( Y @APIS.AA366BayfieldCEGL002479 - Pinus strobus - Populus tremuloides / Corylus cornuta ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Pinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APIS York Island15NAD836.9mJ. Marr, K. Hiser1FlatFlat (n/a)MidslopeflatUpland@plant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m!polygon edge with Alnus viridis@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10612:02x^YYYM        qqqqqkd``````GAA5`````VJE72E0?a&5%A@SA x YY@ <.(( YF @APIS.AA365AshlandCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestMixed Herbaceous Wet Meadow (map class)HWMAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island15NAD839.2mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUpland@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m`@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:15CEGL002457xz<777++++++! oooooib^^^^^^D>>2_____VJE72Eya4,%ASA x Y[@ <.<(Y@g@APIS.AA364AshlandAbies balsamea-Betula papyrifera/Diervilla lonicera ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APISOuter Island15NAD838.3mC. Groebner, N. Murphy1Moderate10 degreesSHigh slopevalleyUplandwell-drainedplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@6@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:15balsam fir, wetlandsxhffPIG@ffff^^VJJH<20 ____VJE12Ea(%ASA x Y[@  P.((Z (@g@ APIS.AA363AshlandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISOuter Island15NAD832.1mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturated poorly drained; standing waterplant stemsCold-deciduousBroad-leavedShrubland 1 - 2 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:55paper birch, aspenxCAA-&$qdd888-!!______VJE12M+ 9am$ASA x Y_@ 2.FF(Yg@APIS.AA373AshlandAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APIS Bear Island15NAD835.7mC. Groebner, K. HiserGentle5 degreesWMidslopehillslopesUpland@ %@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:56Betula papyrifera, Acer rubrum, A. saccharumx=;; wlldUJ=1%%%%______VJE120a$ASA x Y\@ F .22YP<g@APIS.AA372AshlandPicea mariana / Pleurozium schreberi ForestCEGL002447APISStockton Island15NAD836.9mJ. Marr, K. HiserGentle8%NEHigh slopeslopeUplanduplandplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@3@jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:07xyyncXMME6+    ______VJE12E0?a x Y .( Y APIS.AA371BayfieldNO DATA SHEETAPIS15NAD83plant stems <0.5 mJFDNO DATAyuuuuuuuooooooo````VJE#2a$AwSA x Y@\@ Z .<0 ______VJE12Ea$A66+!!  ````VJE16Ma{$ASA x Y@^@ F.F 3' x!`````VJE2E? 5a5%A@SA x Y Y@ 22. ( Y2g@ APIS.AA399AshlandBetula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]CEGL005245APISOuter Island15NAD8310mC. Groebner, N. MurphyFlatFlat (n/a)flatPalustrineSaturated@plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m @mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:40CEGL005245 - birch, maple, sprucex,**zzcXH;;///$______VJE12)Myak$ASA x Y_@ ((.P<Yg@APIS.AA398AshlandThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Bear Island15NAD834mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatUpland@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m`@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1065:15hemlock, cedar, birchx   }}rg\QQI:/""______VJE12E0ahz$ASA x Y@^@ F.(22YFg@ APIS.AA397AshlandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD834.7mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatPalustrine@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mH@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:40birch, alderx tti[K>>2222&& ______VJE12Eya&!%ASA x Y ]@   2.(Y g@ APIS.AA396AshlandEroding clay bank sparse vegetationEroding Clay Bank Sparse VegetationCEGL002584APISMichigan Island15NAD834.1mC. Groebner, N. Murphy1Steep38 degreesNWMidslopebankUpland@plant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak3:40birch, maple, spruce, balsam firxtttti[K>>2222**$ ____VJE12Exoad$AQSA x YZ@ 2F.22 (<< @ APIS.AA395AshlandPinus resinosa/Vaccinium spp. ForestCEGL002520 - Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestPinus resinosa / Vaccinium spp. ForestCEGL002443Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestCEGL002520APISStockton Island15NAD837.0mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aHigh slopeflatUplandD@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m <0.5 m <0.5 m <0.5 m5@&mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:50bogxtttttj`VVK@55-~xxl ____VJE72E5LVALh F  I F^%p 48dry upland; recent blowdowns of cedar so more in subcanopy until recentdry upland; recent blowdowns of cedar so more in subcanopy until recently; lots of sugar maple regeneration in herb layer; canopy about 20m tallpoorly drained; canopy about 20m tallwell-drained soil; fire scars on old stumps; animal trail through polygonwell-drained; beachgrass pocket between birch and aspen trees; poison-ivy throughout polygon; pockets of spikerush and other grasses, each <5%; some Artemisia campestris (<5%)well-drained; minimal blowdown; sparse understory, a few ferns but mostly Taxus seedlings and litter/duffgentle hill slope; pockets of poorly drained soil, dominated by Impatiens but overall this is an upland sitewell-drained; pine forest of red and white oubes, spruce and balsam fir understory, herbaceous is mostly fern and cow-wheat, hiking trail east of polygonwell-drained, major blowdown; herbaceou stratum sparse due to hemlock and cedar canopy, mostly Dryopteris and Taxus understory, subcanopy is mostly cedar, blowdowns of cedar from the roots is recentstanding water; moderately drained; minor blowdown; herb layer spp. <5%; mostly trees and shrubsEvidence of intense blowdown event. Saturated soils adjacent to bog. Soils peaty.well-drained, aspen occupies all floor cover/vegetationdry (although lots of sphagnum); many hummocks and pockets; herbs indicate wetter earlier in season; Abies and Tsuga regeneration in herb layersmall headwater drain; gently sloping uplandmoderately drained; alder thick with small stand of Quercus in NE corner; bordered by leatherleaf to NW; very little herb cover under alder; Quercus could be hybrid or odd looking Quercus rubramoderately well-drained; a few Salix spp. <5%; pocket of purple loosestrife on south side of polygonsome blowdown; well-drained; several red oak but <5%; sparse herb layer due to dense tall shrubs; only herbaceous spp. are Thuja and Abies seedlings (both <5%)low, wet drainage through polygon; large balsam fir component in canopy; some Alnus incana (<5%)hummock/hollow microtopography; muskeg-like with scattered black spruce trees (about 20%)Mesic woods next to running stream. Some sphagnum moss but not 5%. All herbaceous listed equals 1%, other less dominant make up other 1%. Black ash stand right on polygon margin. Stream 2" wide running through polygon.mesic woods; evidence of old blowdown; moss-covered logs and sparse ground cover; yellow birch (large dbh) is common blowdown speciesmoderately to well-drained; some blowdown; standing water in tip-ups; sparse understory due to hemlock seedlings, Taxus, and small shrubspoorly drained; a mix of canopy spp. and shrub layer; dominants hard to determinemesic woods; evidence of blowdown; campground 20m to westupland, dry; near road; slight slopesome areas of standing water, others dry ground (meadow); old beaver dam at ESE end of clearing (may be a pond beyond this); narrow water-filled channelshummock/hollow microtopography; scatter tall-shrub black spruce and tamarack; moister areas with Menyanthes; Chamaedaphne dwarf-shrub size (to about 40 cm tall)poorly drained; small stream present through polygon on north sidepoorly drained; standing water; beaver ponds with dams and dead snags; Impatiens capensis dense on dams with Rubus idaeus; a few pockets of Iris versicolor <5%about 20m from steep bank to west; many fallen trees (blowdowns?), tops of spruce; cedar trees shredded bark; mostly litter/duff, very few herbaceous spp. due to dense canopymoderately well-drained; polygon is narrow by AA point, then opens up into a mix of alder, Myrica gale and Calamagrostis; herbaceous stratum is a mix of grasses, those not listed <5%. purple loosestrife scattered in open areas <5%1t Ia#ASA x Y]@ <.(2( Y< g@APIS.AA404BayfieldPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APIS mainland15NAD836.2mJ. Marr, K. HiserGentle1 degreeNMidslopeflatUpland&@plant stemsMixed evergreen - cold-deciduousMixedWoodland15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1064:16x    uukdB55))))!!``````VJE12E0?a_$ASA x Y^@ (2.  Y`i@APIS.AA403BayfieldEroding Clay Bank Sparse VegetationCEGL002584APISRaspberry Island15NAD833.7mC. Groebner, N. MurphyModerate12 degreesNLowslopebeachUplandwell-drained; some blowdownplant stemsMixed evergreen - cold-deciduousMixedSparse vegetation10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 mX@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:30cedar, birch, maplex-++ngE88``````VJE12Ea$AbSA x Y\@ F.( YP  @APIS.AA402AshlandWet meadow mixed herbaceous mapclassCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257Mixed Herbaceous Wet Meadow (map class)HWMAPISStockton Island15NAD8311.6mJ. Marr, K. HiserFlatFlat (n/a)Low levelflatPalustrineSaturated@plant stemsPerennial herbGraminoidHerbaceous vegetation 1 - 2 m <0.5 m <0.5 m@ Z@#jmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10610:45Forest - Acer, Betula papyrifera, Quercusxslj`"~ssggaaNNNNNG@<<<<<<_____VJE72Mpa$ASA x YZ@ _.( <(Zg@ APIS.AA401AshlandCEGL005228? - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD836.5mJ. MarrGentle1 degreeSELow levelflatPalustrine@15% plant stems, 80% sphagnumEvergreenBroad-leavedDwarf shrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus63:35Same as primary veg assocxyttthhhhhh^TJ?4444# uooc _____VJE72Ea1%A'SA x Y Y@ <.<2YFZg@APIS.AA400AshlandCEGL005245 - Betula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071Betula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]CEGL005245APISOuter Island15NAD839mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturatedD@plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m&@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:15CEGL005245 - maple, birchxvvvvvvlbbWL@55-&pjj^_____VJE72Mf Dan5%AgSA x YY@ P .P Y g@APIS.AA409AshlandCEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Tsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISOuter Island15NAD838.5mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflatUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@MJROpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:22Mixed conifer-deciduous throughoutxB===111111'yqq]]]]]WPLLLLLL2,, _____VJE72E0a8C%AuSA x YX@ 2 .( Yg@APIS.AA408AshlandTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISOuter Island15NAD837.6mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUpland@ plant stemsCold-deciduousBroad-leavedForest@MJROpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:50CEGL005245xrmmmaaaaaaaaaaaaaaYK;..""""______VJE12Ea$ATSA x Y\@  Z.2< <(2g@APIS.AA407AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD839.6mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineS@plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 mD@MJROpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:10birch, maple, alderx?==(" wpNAA5555))#  ______VJE12Eaz$AISA x YX@  (2.< Y @APIS.AA406AshlandCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISBasswood Island15NAD839.8mC. Groebner, N. Murphy, B. DunlapGentle2 degreesVariableHigh slopeflatUpland;@steep ravine to northplant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mD@ one basswood in subcanopymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:26Cold-deciduous throughoutxDBB' vkkcUE8    {{o_____VJE72Űap$ASA x Y`@ <.F Yk@APIS.AA405AshlandThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Cat Island76315NAD836.4mK. HiserFlatFlat (n/a)MidslopeflatUpland dry uplandplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10611:15x{pee]V4''______VJE16E0?LVAL : ( r ~ fv&scattered trees but only about 10% cover; alnus shrubland with 80% alnus coververy little Thuja in canopy so not enough for CEGL002450 (plus Betula allegh. not noted; not enough Quercus for CEGL002461<25% relative cover of conifers in canopy, therefore deciduous type; CEGL002105 with >25% Fraxinus; could also be CEGL002071definite conifer forest; red pine most common in canopy; CEGL002443 fairly good fit; with red pine dominant with white pine and black spruceborders bog with some bog plants (<5%); yellow birch dominant, not much maple or hemlockCEGL005044 has more hemlock but still >25% hardwoodsassessed from trail through polygon; open areas of standing water with sphagnum mat; sides of wetland are black spruce-dominatedKeys out easily. No ash but large tall-shrub Alnus incana component.keys to CEGL002589 but does not fit description very well (which is based on jack pine-dominated site on Long Island); had to compare with other descriptions to decide; Vaccinium species absent; most shrub species given in primary and secondary vegetation descriptionsconifer forest (deciduous canopy <25%); keys to CEGL002590 (CEGL002598 is similar but should have no to little white pine)alder is dominant with Quercus in the NE cornermix of Calamagrostis and alder; more grassesThuja is dominant; balsam fir mostly in tall-shrub layermore aspen than birch compared to spruce; close call between balsam fir and aspena treed version (about 20% black spruce) of CEGL005277; not enough tree cover for CEGL005271, although it fits it in some respects; tree cover may be low (woodland); short-shrub layer may be dense, etc.>25% cover deciduous trees in canopy so keyed to CEGL005044; could also be CEGL002598 if cover was overestimatedno sugar maple (only red maple); polygon split almost equally on yellow birch and hemlock; due to understory when with hemlock dominantdifficult to narrow down; best fitF bal#A@SA x Y@X@ .FYFg@APIS.AA413BayfieldCEGL002474 - Abies balsamea - Betula papyrifera / Diervilla lonicera ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Abies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APISMeyers Beach15NAD838.2mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandb@ plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@MJROpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:05CEGL002466 - Balsam fir, aspen, birchx\WWWKKKKKKKAA6+  zvvvvvv\VVJ `````VJE72Ea>$A'SA x Y]@ (2.P((FY _@APIS.AA412AshlandTsuga canadensis - Acer saccharum - Betula allegheniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISIronwood Island15NAD833.0mC. Groebner, N. Murphy1FlatFlat (n/a)High levelhighlandUpland well-drained, minimal blowdownplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@nmOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:00birch, hemlock, cedar, maplexvomf'# mmmmee[OOCC=;#####____VJE12Ea\$ASA x YZ@ P.(2 Zg@APIS.AA411AshlandCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island01615NAD834.5mJ. MarrGentle2 degreesSLow levelflatPalustrine[@ 20% plant stems, 80% sphagnumEvergreenBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@MJROpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus74:48S - is similar but no tree size Picea marianax|rh]RF;;0"~xxl_____VJE76Ea $ADSA x Y@W@ F .< Y @APIS.AA410BayfieldAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002105 - Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island41015NAD832.5mC. Groebner, N. Murphy, B. Dunlap1FlatFlat (n/a)High slopeflatUpland@ plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mkeys out easilymjrOpt1= Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak61:46 PMx ttl^NAA5555--' QE````VJE76E?^LVAL* ( 7 c *  i U*Ng8cover values not given for all taxa and those listed are not recorded in the usual way but rather give relative cover for each stratumcover values not given for all taxa and those listed are not recorded in the usual way but rather give relative cover for each stratum, had to interpolate species covers; some taxa identification uncertain as only common names was listed; strata not well-differentiateddue to we bog mat, took GPS reading from marginDense pockets of balsam fir. A couple of Ash in T2 stratum on margin of polygon.No Canada yew? One Picea glauca in stand <5%.no cover values for individual species recorded; uncertain of some taxa because only common names were givenspecies cover values had to be interpolated as values were not determined in the usual way but rather as relative coverQuercus hybrid (rubra x ellipsoidalis) occurs here, so reported as Quercus sp. as uncertain of its IDOpen wet field. Surrounding alder to the south and apple trees and Populus tremuloides to the north.Herbaceous stratum is dominated by Rubus pubescens and next Calamagrostis canadensis. Rest of species listed equal "P" combined plus site had a mixture of <5% other herbaceous plants.Some recent blowdown of balsam fir. Area has several large-dbh Populus tremuloides.Hawkweed and Ranunculus - observed fair amount. Rabbit browse on margins of polygon.Very narrow band next to lake. Apple tree on bank, over 50% barren clay bank. Bank has bare spots with erosion.Typha present near point; W of polygon is channel connected to Lake Superior that is 2562 or 2282.Point close to polygon boundary with other asssociation which has less balsam fir and red maple, more aspen. Several uprooted balsam fir but not a recent disturbance.species list includes both community types (beachgrass and treed portion); herbaceous species are for beachgrass community; most woody species line the western edge of the polygonUTM for one of the openings in the polygon is 686930, 5198609UTM point is about 15m south of AA point (which is in deep water) at bottom of steep forested slope of mostly red pinelooking SE, tops of hemlock are broken off, blowdown on recent cedar, herbaceous layer sparse with needles from cedar through last three listed, herbaceous spp. All less than 5%Low herb diversity; scattered black ash trees; no sphagnum seen; natural disturbance (a few broken off alder at 1m height); various sedges and grasses (Calamagrostis can. & Glyceria striata); Cirsium sp. (exotic) in vicinity of plot; Taraxacum officinale (>>>>>````VJE12E< '  Ta$A0SA x Y@^@ .( Zh@ APIS.AA427AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS Long Island15NAD834.7mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland@plant stemsPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m <0.5 mbeachgrass dominantmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First Photo69:00birch, sand dunex uuuuu^SC66****""______VJE12Ewa9%ASA x YX@ <.F2FFYh@APIS.AA426AshlandBetula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]CEGL005245APISOuter Island15NAD835.4mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatPalustrinek@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First Photo64:15CEGL002457 - Maple, birchx{pphZJ==1111%%______VJE12EwaX$A@fSA x Y@\@ <.2>22,* ____VJE12E da%ASA x Y@]@ ( . (PY<h@APIS.AA432AshlandAlnus incana Swamp ShrublandCEGL002381APISMichigan Island05915NAD8312.4mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrines@plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:50x{{{{{{qgg\QQFF;-}______VJE16Epy?a$ASA x Y`@ <.<2(Y h@APIS.AA431AshlandAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISOtter Island77415NAD837.6mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland@20% plant stems, 5% sphagnumCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:04x  |qqi[K--!!!!  ______VJE16E0?a#ASA x Y`c@F .< Yh@APIS.AA430BayfieldCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APIS Sand Island03515NAD837.4mJ. Marr, M. Smith2Moderate10 degreesNW304LowslopedrainagePalustrineSaturated'@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon73:28xwwwwwwmcccXMBB:,uooc `````VJE76M0?a^$ASA x YZ@ <(.<Y( @APIS.AA429AshlandCEGL002447? - Picea mariana / Pleurozium schreberi ForestPinus resinosa / Vaccinium spp. ForestCEGL002443Picea mariana / Pleurozium schreberi ForestCEGL002447APISStockton Island15NAD832.5mJ. MarrGentle4 degreesNEHigh levelflatUplandK@K@20% plants stems, 20% mossEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus75:20Large polygon to N-mostly Sphagnum and ericaceousxkecZ      uuuummg[[WLDD;;;;;5.****** _____VJE720a x Y .( Y APIS.AA428BayfieldNO DATA SHEETAPIS15NAD83plant stems <0.5 mJFDNO DATAyuuuuuuuooooooo````VJE#2LVALi  R l N _ @ #$z9a%8Twell-drained; Quercus and Betula in canopy with Tsuga canadensis; dominant in subcanwell-drained; Quercus and Betula in canopy with Tsuga canadensis; dominant in subcanopy with sugar maple and yellow birch; understory 1/2 litter/duff due to dense canopysome downed trees; low corridor with flowing stream; assessed bottomland and slope; herb layer a mix of Carex and grasses <5%; also a mix of ferns, only ostrich fern is >5%swampland with pond scattered throughout polylgon; Typha, bracken fern and blueberry along margins of polygon; nearby Pinus strobus treesMesic woods, evidence of blowdown. Dense herbaceous stratum. Rubus pubescens dominant. Many other minor species.well-drained; several shrub size tree's <5%; Ammophila is dominant herbacerous sp.; with pockets of Prunus and <5% Spireawet with areas of standing water; very low plant diversitypoorly drained soil; very dense Abies tall-shrub layer (5-10m); many tree species are about 5m tallrotting mossy logs; mesic to moist site; drainage parallels west side of polygon; Pinus strobus somewhat emergentwell-drained; sparse understory due to dense hemlock, mostly ferns and Streptopus; lots of moss-covered boulderspoorly drained; standing water; some ash but <5%; other grasses Poa spp.; beaver influence; Impatiens dense on beaver dam; saturated and standing water on peat; a mix of Sparganium and grasses are dominantdry alder thicket (has been dry for awhile as lots of Hieracium has come up); site being invaded in shrub layer by aspens and other trees (5-10m tall); no sphagnum seenpoorly drained; standing water; some blowdown; herbaceous spp. on dry hummock and moss mat; grasses and sedges in wet pockets; more maple and birchupland, well-drained; trees <1m tall are sugar maple, red maple, Thuja; lots of sugar maple regenerationpoorly drained; some standing water; open wetland meadow with pockets of standing water and flowing water; narrow corridor running NE-S; lots of downed trees and standing snags; evidence of past beaver dam and activityshallow drainage; poorly drained; depression seasonally floodedmore or less poorly drained; dry now; moss-covered logs; recently downed cedars; opening with Acer spicatummoderately well-drained; some blowdowndry upland; slight slope; recent cedar blowdown (more cedar in area in past); tallest Tsuga is up to 35m, other canopy species up to 20mwet, saturated soil; little standing water; standing dead trees; beaver-disturbed site (chewed stumps)well-drained; major blowdown; sparse herb layer due to slope and dense overstory; other than sugar maple seedlings, list spp. are <5%well-drained; sugar maple and oak seedlings on forest floor, otherwise sparse herbaceous and shrub layersmesic forest; some blowdowns and hummocks - uneven grounddry; topography is overall flat, but ground is very uneven (pockets and mounds); cedar, sugar maple, hemlock seedlingsbeaver dam may be SW of point; standing water in sedge-dominated emergent zone; standing dead trees; beaver-chewed stumpspart of polygon is wet (shrub swale) with alder and Myrica shrubs, other part is higher and drier (trees)well-drained; bank/cliff edge; herbs in cracks and along forest margin; all spp. <5%Mesic woods, boardwalk running through point, small water-filled ditches on sides of boardwalk.0.5- to 1-m wide water-filled channel; poorly drained narrow drainage with black ash and alderwell-drained; tall-shrub and subcanopy not too dense; dense herb stratumdry upland; ground very uneven; hummocks and pockets throughout; most of polygon is dominated by Tsuga (and birch species), but some areas (especially near GPS point) are Tsuga/Acer mix with Acer also in lower stratawet with channels and drier hummocks throughout; beaver-chewed stump; about 8x8m cedar "island"; trees 10-5m tallLVAL0f L B :H\CEGL005174 selected based on grasses present; no single species dominantmixed deciduous forest; keys readily to CEGL002457; some areas in 0.5-ha area had more oak than others, but didn't seem to be enough for CEGL002461graminoid and herbs; birch, maple and hemlock surround polygon; equal amounts of sedges and grasses; birch and maple scattered throughout area of polygonKeys out to Populus tremuloides/Betula papyrifera forest adjacent to beach. Narrow band of vegetation on bank up from rocky shore.about 25% cover deciduous trees so keys to either CEGL002449 or CEGL002450; seems to fit the latter better (young cedar - yellow birch forest); no mention of yellow birch in description for CEGL002449best fit; has a mix of tall trees but sparse compared to cedar and balsam fir in subcanopymixed type; keys to CEGL005044 (Tsuga has greater cover than Thuja)area nearest point is wet meadow mixed herbaceous class; further from point alder is presentdominant birch and aspen with some hemlock but not enough to consider CEGL005044mix of oak and bigtooth aspen in canopy; with oak in subcanopy, could move into oak-dominated (CEGL002461)best fit; no balsam fir; mostly paper birch and aspen with maple subcanopy0.5-ha area is beaver pond in part; greater than half of area has emergent graminoid vegetation (<25% cover of Calamagrostis compared to Cyperaceae; Scirpus cyperinus is common)CEGL002589 or CEGL005125 for northern half?; confusing; divide polygon into 2 types?mostly just sandstone slab but some vegetation along margin and in cracks; edge to forest is not a cliff <2 feet high so put in bedrock classKeys out to Quercus and Acer, Quercus closer to 30%. Best fit sugar maple, aspen and oak equal cover.aspen dominant with birch and spruce; some maple in canopy and subcanopyprimary type is determined by vegetation lower on slope (to north); secondary is by vegetation higher on slope, along south part of polygon, nearer to GPS point  az$A@SA x YY@ F.(Y h@ APIS.AA437AshlandSandstone Great Lakes Shore Cliff Sparse VegetationCEGL002503APISDevils Island15NAD832.3mC. Groebner, N. MurphyFlatFlat (n/a)Channel wallbankPalustrineV@plant stemsCold-deciduousBroad-leavedSparse vegetation 2 - 5 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera,Opt2=Number of Images, Opt3=Time of First Photo4:25CEGL002447 - Spruce, birch   |qqffSE5(( ______VJE12Eyga$$A@SA x YW@ P .<(Y2 @APIS.AA436BayfieldQuercus rubra - Acer saccharum ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestQuercus rubra - Acer saccharum ForestCEGL002461Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Sand Island43615NAD837.5mC. Groebner, N. Murphy, B. Dunlap1FlatFlat (n/a)High slopeflatUplanda@plant stemsCold-deciduousBroad-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@c@mjrOpt1=Camera,Opt2=Number of Images, Opt3=Time of First PhotoKodak66:01 PMx|wkk______UKK@5)}}xxxx_YYM ````VJE76E?a#A@SA x Y`c@  .(2 Y2h@ APIS.AA435BayfieldFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island02715NAD83J. Marr, M. SmithGentle1 degreeNMidslopedrainagePalustrineSemipermanently flooded`@plant stemsCold-deciduousBroad-leavedWoodland15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 mwoodland physiognomic classmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon7NAx><<<86/vfYYMMM4((``````VJE16M?a*$ASA x Y_@ (2.F(SA x Y _@ F .P(Y(h@APIS.AA441AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APIS Bear Island15NAD836.0mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatUplandx@F@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 mhemlock dominantmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10612:54Maple, birch, cedar - some hemlockx533{pee]V4'______VJE120a7%ASA x Y Y@ < .( Y2 @ APIS.AA440AshlandWet meadow mixed herbaceous mapclassCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257Mixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island44015NAD834.3mJ. Marr, B. DunlapGentle2 degreesVariableHigh levelbeaver pondPalustrineSemipermanently flooded{@plant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 m <0.5 mb@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:18Abies, Acer rubrum, Betula papyrifera Forestx|usl.)))       vkccOOOOOIB>>9999_____VJE76Ma$b$A:SA x Y ^@ F . Y( @ APIS.AA439AshlandCEGL002518 - Pinus banksiana - Populus tremuloides / Diervilla lonicera ForestPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125Pinus banksiana - Populus tremuloides / Diervilla lonicera ForestCEGL002518APIS Long Island08315NAD836.6mJ. Marr, K. HiserGentle1 degreeVariableMidslopeswaleUplandk@plant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10511:48SEE COMMENTSx{{ooooooe[[PE9..$ ztth%_____VJE76E0a x Y .( Y APIS.AA438BayfieldNO DATA SHEETAPIS15NAD83plant stems <0.5 mJFDNO DATAyuuuuuuuooooooo````VJE#2 42a$A@/SA x Ya@ 2.F222Y @APIS.AA447AshlandCEGL002450? - Thuja occidentalis - Betula alleghaniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISOtter Island78215NAD837.7mJ. Marr, K. HiserGentle3 degreesNMidslopeslopeUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1069:53xHCCC777777-## lllllf_[[VVVV<66*_____VJE76E0?a+%ASA x Y ]@ . (YF< @APIS.AA446AshlandCEGL002381 - Alnus incana Swamp ShrublandMixed Herbaceous Wet Meadow (map class)HWMAlnus incana Swamp ShrublandCEGL002381APISMichigan Island03715NAD837.5mJ. Marr, K. HiserFlatFlat (n/a)Channel bedchannelPalustrineSaturatedh@ plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10512:29NE - Betula papyrifera ForestxgeeF?=3yymmmbVVM@@44..  _____VJE76Mya8~$AhSA x Y `@ <.P<(Yh@APIS.AA445AshlandPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS Oak Island15NAD833.6mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland@ plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak67:55oak, maple, birchx{pphZJ==1111))#  ______VJE12Ea %ASA x Y@]@ 2 .(i@APIS.AA444AshlandJuniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandCEGL005064APISMichigan Island06315NAD834.4mJ. Marr, K. HiserGentle2 degreesVariableMidslopedune (undifferentiated)Upland dry, sandyplant stemsMixed evergreen - cold-deciduousMixedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1055:20xKIIICA7ss[[[[SS:00&______VJE16E8?a$APSA x Y`@ <.Z2 Yh@APIS.AA443AshlandCEGL002461 - Quercus rubra - Acer saccharum ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Quercus rubra - Acer saccharum ForestCEGL002461APIS Oak Island15NAD832.1mC. Groebner, N. MurphyModerate8 degreesSMidslopeslopeUplandk@ '@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:00birch, maple, oak, pinex|usl.)))vllTTTTTNGCCCCCC+%%_____VJE72Ő?+ !Wa`=%A@LSA x YX@  <.($A4SA x Y@c@ F.<2(Yh@APIS.AA449BayfieldCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island02015NAD839mJ. Marr, M. SmithFlatFlat (n/a)MidslopeflatUplandm@10% plant stems, 5% sphagnumMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon72:35xUPPPDDDDDD:00%lllllha]]XXXX?99-`````VJE76E0?a$A@SA x Y [@  2.(< Zdh@APIS.AA448AshlandThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456APISDevils Island15NAD832.7mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatPalustrine(@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak1:15CEGL002447 - spruce, fir, birch, aspen:::  wlldUJ==1111%%______VJE12Eo = ax$A#SA x Y@^@ F. (PY2 @APIS.AA456AshlandCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana Swamp ShrublandCEGL002381Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD832.5mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrine@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mkeys to CEGL002381mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1059:44xD??? pppppjc______F@@4_____VJE72E0y?a$p$ASA x Y ^@ F .<2Y( @APIS.AA455AshlandCEGL002589 - Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestPinus banksiana - (Pinus resinosa) - Quercus ellipsoidalis / Carex pensylvanica ForestCEGL002478Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APIS Long Island09115NAD831.9mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland dry uplandplant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mB@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:29N - Ammophila type (5098)xrmmmaaaaaaWMMB7+  ||wwww^XXL_____VJE76E8a$ASA x YZ@ <(YFg@APIS.AA454AshlandAcer rubrum-Fanxinus spp.-Betula papyrifer/Cornus canadensis ForestAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISStockton Island15NAD837.8mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrineSaturated@plant stemsCold-deciduousBroad-leavedShrubland20 - 35 m10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:15red pine to southxoig`"  xxrfaUPJH00000*#____VJE12Ma$AqSA x Y`\@ P .F(Y( h@APIS.AA453AshlandCEGL002461 - Quercus rubra - Acer saccharum ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Quercus rubra - Acer saccharum ForestCEGL002461APISStockton Island - Quarry Bay15NAD837.9mJ. Marr, K. HiserGentle1 degreeNWMidslopemoraine (undifferentiated)Uplandj@plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m&@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1061:28x{=888,,,,,," {qiiVVVVVPIEEEEEE _____VJE72E0?LVALr   p PjDnperfect fit with mostly Picea, Pinus, Larix with some understory paper birchCEGL002467 has Abies in canopy and dense shrub layer; deciduous forest dominated by paper birch; northern hardwoods (yellow birch and maple) is CEGL003370 (close to 25%) ; = CEGL002468?; might have been CEGL002474 before Abies blowdownbest fit; more black ash but good-sized cedar trees in cedar standsConfident of association with Alnus swamp, although fair component of Fraxinus present (but still less than 25%)deciduous swamp forest; keys to CEGL002071; lots of alder; canopy cover (50%) more like woodlandkeys to CEGL005125 although no Pinus banksiana present and is a much wetter example than others on the island; secondary CEGL005271 although not a good fitThuja dominant with birch and firpoint is in deep water; UTM is about 10m north of pointCEGL002457 - mix of Acer, Betula and Quercus; CEGL002461 - possible that there is a little more Quercuscanopy dominant is paper birch; has dense Acer stratum and alder tall shrubs; best fitleatherleaf and Myrica gale are dominant; too dense shrub layer for herbaceous spp.Keys out easily. A small amount of ash, balsam fir and spruce in SW corner.since Betula pumila is present, this alder swamp shrubland seems to better fit CEGL005227 (primary) than CEGL002381 (secondary)difficult to fit into one type, seems like a combination of categories: Tsuga is more dominant at GPS point; Quercus is dominant going west, and farther west sugar maple and paper birch are dominant<25% deciduous, therefore coniferous type; either CEGL002456 (dominated by Thuja) or CEGL005271 (dominated by Picea mariana); both have canopy cover of 20%; description of CEGL005271 does not include Thuja, so placed in CEGL002456 as primary[comments too confusing to transcribe]keys to CEGL002589 (canopy is codominated by a mix of pines); Quercus rubra/ellipsoidalis? has about 33% cover but is not mentioned in description for CEGL002589 1aZ$ASA x Yc@ _.<< Y (h@APIS.AA461BayfieldCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APIS Sand Island05115NAD839.7mJ. Marr, M. SmithFlatFlat (n/a)MidslopedepressionPalustrinee@15% plant stems, 80% sphagnumEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon76:09x~yyymmmmmmcYYYNC880!uooc`````VJE76E ?a&$A8SA x Y@\@ P .<(Yh@APIS.AA460BayfieldPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APIS mainland15NAD8310.3mJ. Marr, K. HiserModerate7 degreesNWMidslopehillsUplands@t@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m0.5 - 1 m <0.5 m <0.5 mL@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:23x    ~sskdB5)``````VJE120g?a$ASA x Y\@ 2.P( Y<h@APIS.AA459AshlandTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD833.8mC. Groebner, N. MurphyGentle5 degreesNHigh slopeslopeUplandr@plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:00birch, spruce, cedar, hemlockx~shh`RB55))))!! ______VJE12EaJ#ASA x Yd@ P .< (k@APIS.AA458BayfieldCEGL002467 - Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467APIS15NAD834mU. GafvertGentle6%WInterfluve/SummitinterfluveUplandgently sloping; moistplant stemsCold-deciduousBroad-leavedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 mf@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoLumix610:46x~rrrrrrrrrh]RG;00( x!`````VJE2E0?a%ASA x Y@]@ F.(YZ @ APIS.AA457AshlandWet meadow mixed herbaceous mapclassCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174Mixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD839.8mC. Groebner, N. MurphyFlatFlat (n/a)LowslopeflatPalustrineSaturated@plant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:10maple, fir, birchxjhhUNLEttnddXXRR:::::4-)))))) _____VJE72MaLVALyv = > p 'h!z,Ldry upland; lots of sugar maple regeneration (herb and tall-sdry upland; lots of sugar maple regeneration (herb and tall-shrub layers); recent large aspen blowndown; fire-scarred stumpsdry; ground uneven throughout but not really sloping; sugar maple seedlingswet along middle of polygon (with standing water); low, wet part runs east-west along middle with north- and south-facing slopes along it; canopy near 10m tall mostly confined to swaleswell-drained; eroding clay bank; all herb species <5% but listed some of the more commonvery poorly drained; standing water with 1/3 of area; saturated sphagnum mat; drier mound areas with leatherleaf; Pogonia ophioglossoides present but <5%; dominant Carex is C. exilis but a significant amount of Cladium mariscoides;well-drained; major blowdown (old and new); very little herb layer due to dense Taxus and blowdownspoorly drained; standing water; snags in beaver pond dam to east and south with grasses and Rubus occidentalisrocky shoreline on NW end of island; <5% Picea glauca; not a tall canopy; looks like pine plantation; herb layer mostly pine needles; small pocket of red oak <5%; area is mostly coniferEvidence of blowdown throughout plot. Mesic woods. Area is wet, Cornus canadensis most common understory herbaceous plant.recently chewed (beaver) alder trunks; Fraxinus likely Fraxinum nigrawell-drained; several subcanopy Thuja <5%; forest floor mostly pine needlesbeaver? pond; wet (permanently); old beaver dam overgrown with Impatiens capensis and Rubus; standing dead treespoorly drained; some blowdown; alder dominant with red maple and birch and some spruce taller in canopy; sphagnum mat on hummocks with Trientalis and ladyslippers <5%; ferns found in depressionswell-drained; ash dominant; several old-growth aspen; wet pockets of standing water with Caltha and Glyceria; drier areas with Rubus pubescens dominantsedge-dominated wetland (currentlyl dry); wet in springSpongy ground with lots of sphagnum, swampy terrain with frequent pools of stagnant water. All herbaceous equal 5%. Area is very wet with treed overstory. Dense mat of sphagnum.dry; shallow depressions wet in spring; low herb cover; sphagnum patches; narrow treed strip of red maple between alder community and cobble/sand beachdry; many recently blowndown trees; birch defoliated; understory mostly sugar maple seedlings with some Taxus and far amount of mountain maplewell-drained; blowdown; dense understory with fern and mountain maple; <5% Canada yewmoderately well-drained; herb species all <5%, mostly sphagnum mat and Ledumdry upland; many blowdown trees (woodland), including fairly recent alder and yellow birch; lots of canopy Abies down but still much standing but not much cover; lots of sugar maple regeneration; canopy-sized red oak, more Abies in canopy in recent pastrich mesic forest; cedar blowdowns old and recent; dominant understory stinging nettle and alder shrubswell-drained; about half and half sand cherry and beachgrass; some pin cherryFast-moving stream to NW of UTM point. Saturated clay soil, possibly influenced by recent rainfall prior to visit; old beaver-chewed stumps; old beaver dam in area (E); plot in floodplain of creek.seasonally flooded, hummock/hollow microtopography; shallow moist depressions with Carex, etc.fire-scarred stumps; blowdowns; Picea mariana regeneration (<1m tall); dense shrub layerwell-drained; major blowdown; very little herb layer due to dense Taxus and blowdowns; most litter/duff and bryophytes on downed trees with pockets of sphagnumdry beach/low dune with areas of saturated soil; more or less parallel to shore, behind foredunebeaver dam about 25m west of point; beaver-influenced site (very freshly chewed stumps); area more flooded than shown on aerial photo  kajc$A25% conifer cover); >25% deciduous in canopy; however, to get to CEGL005003 need to have <25% deciduous and to get to CEGL002590 need to have well-drained soils (pools of standing water in 1/2 ha); so neither keys well2 types within polygon; Myrica (Alnus) swale and woodland type; part of dune swale complex; put in one type (CEGL005125?) or separate into 2 types: Myrica shrubland and jack pine woodlandAA point is on line; assumed it was the bank along lake; more vegetation than 662 but best fit is CEGL002584no vegetation association for graminoid-dominated so used CEGL005228 as best fitThuja dominant with a mix of birch, spruce, firAA point was on line; assessed wet beaver pond roughly NE and SW; 50% water, rest mixed sedges and grasses with shrubs on margins and damkeys out easily; Pinus resinosa may have been planted; abandoned structure presentKeys out easily. Tallest trees are aspen, birch and spruce, mostly cedar. One pocket of ash.dominant red pine with oak subcanopymost of 1/2 ha is graminoid mix; about 10% is pond with aquatic community (CEGL002282) dominated by Potamogeton; floating and submerged leave so doesn't key to 46BCEGL002105 - no cedar just red maple most dominant deciduousKeys out to primary but without Fraxinus. Best fit but secondary choice more trees than "scattered" in literature, no ash. Only possible fit with tree cover; better fit having alder would be CEGL002449 but no white-cedar present.keys to CEGL002381 (scattered Thuja and Fraxinus nigra)oak dominant with paper birch; some cedar and sugar maplePinus banksiana woodland; most oaks seem to be in subcanopy but nearing canopy size; keys to CEGL002478 (25% oak in canopy)more cedar in CEGL002450; no sugar maple, instead dense mountain maple in CEGL005245 < pa$A@SA x Y`@ < .( YP h@ APIS.AA486AshlandCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APIS Cat Island75615NAD834.4mJ. Marr, K. HiserFlatFlat (n/a)flatPalustrineSeasonally flooded9@plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1054:03xxm]PPDDD0$$  ______VJE16)M0?a$A@qSA x YW@ 2(.(2(YPg@APIS.AA485BayfieldAlnus incana Swamp ShrublandCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestAlnus incana Swamp ShrublandCEGL002381Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APIS Sand Island48515NAD837.5mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturated@ 20% plant stems, 20% sphagnumCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:44 PMS - Populus; N - A. rubrumx   yyncWLLA3#}}xxxx_YYM~````VJE76M0a$ASA x Y`@ 2.(F Y  @ APIS.AA484AshlandCEGL002105 - Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestAlnus incana Swamp ShrublandCEGL002381Fraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Cat Island75515NAD839.7mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrine@ plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m <0.5 m <0.5 mn@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:26xv8333''''''zzzzztmiiddddLFF:_____VJE76E0?aZq$ASA x Y_@ 2.P(F(Fh@APIS.AA483AshlandQuercus rubra - Acer saccharum ForestCEGL002461APIS Bear Island15NAD836.6mC. Groebner, K. HiserGentle2 degreesWMidslopeslopeUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mr@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:02Acer saccharum forestx   }rg\QQIB ______VJE12E0a>$ASA x Y]@ 2 .P( FYg@APIS.AA482AshlandTsuga canadensis-Acer saccharum-Betulla allegheniensis ForestTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISIronwood Island15NAD838.9mC. Groebner, N. Murphy1FlatFlat (n/a)High levelflatUplandwell-drained; major blowdownplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:00cedar, birch, hemlock, maplexc\ZSffff^^XLL@@:8     ____VJE12E$3 ~<a4 $ASA x Y`^@ ((.(P Y<h@ APIS.AA491BayfieldAlnus incana Swamp ShrublandCEGL002381APISmainland - Sand Road50015NAD836mJ. MarrGentle1 degreeNLow levelflatPalustrineG@plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m <0.5 mkeys easily to CEGL002381mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus64:10xbbbbbbbXXXMMBB7)  ~``````VJE16EП?a.$AwSA x Y`@ <.$ASA x Y W@ 2 .2(YF @APIS.AA492BayfieldThuja occidentalis - Abies balsamea - Acer spicatum ForestCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island49215NAD836.8mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatUpland|@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak69:01 AMx{{peZOOG@{uui-!````VJE76E? S la:%A@SA x YY@ P.F< Y i@APIS.AA500AshlandCEGL005003 - Tsuga canadensis - Betula alleghaniensis Saturated ForestPinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590Tsuga canadensis - Betula alleghaniensis Saturated ForestCEGL005003APISOuter Island50015NAD8312.1mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak10:19S - Mixed conifer-Deciduous (5044)x~@;;;//////%zzfffff_XTTOOOO5//#_____VJE76Eoad$A9SA x Y ^@ F. 2Y @APIS.AA499AshlandCEGL002518 - Pinus banksiana - Populus tremuloides / Diervilla lonicera ForestPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125Pinus banksiana - Populus tremuloides / Diervilla lonicera ForestCEGL002518APIS Long Island08515NAD835.3mJ. Marr, K. HiserGentle2 degreesVariableHigh slopeswalePalustrineSaturated@plant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mv@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10512:48N - Ammophila type (5098)xwmmbWK@@6'ztth%_____VJE76Ma(%AQSA x YY@ .( Y h@ APIS.AA498AshlandCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestEroding Clay Bank Sparse VegetationCEGL002584Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISOuter Island15NAD837.8mC. Groebner, N. MurphySteep34 degreesEToeslopebankUplandZ@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First Photo612:10CEGL002468 - populus, aspen, birchxD???3333333))zsooooooUOOC_____VJE72Eywa $A@SA x Y`^@ 2.(F Y<h@APIS.AA497BayfieldAlnus incana Swamp ShrublandCEGL002381APISmainland - Sand Road49815NAD838mJ. MarrGentle1 degreeNLow levelflatPalustrine3-m wide channel near pointplant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m <0.5 mkeys easily to CEGL002381mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoOlympus63:15xtttttttjjj____TF6)~``````VJE16?a$ASA x YZ@  Z.( Fdh@ APIS.AA496AshlandChamaedaphne clyculata-Myrica gale/Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD838.4mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@80% plant stems, 10% sphagnumPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak68:55white pine/coniferxpjha#uuod_SNHF.....(!____VJE12MLVALF v |  ;`$dry; dead snags of birch and 2 large hemlock blowdowns; cedar blowdown recent; some pockets of sphagnum with Caredry; dead snags of birch and 2 large hemlock blowdowns; cedar blowdown recent; some pockets of sphagnum with Carex lacustris; cedar and hemlock seedlings; stripped bark on cedar; sparse understory due to dense cedar and hemlockvery poorly drained; standing water; some Taxus in understory (<5%); along sunny side of polygon to east are a few <5% herb species; very narrow polygon assesses, alder and cedar; no herb layer due to dense Abiesno sphagnum seen; depressions, moss-covered logswell-drained; on gradual slope; forest floor mostly sugar maple seedlingswell-drained; polygon is on a knoll or ridgetop between 2 steep drainages; lots of blowdowns; sparse understory due to hillside and many blowdownsdry upland; old sphagnum-covered road through polygon; lots of sugar maple regeneration in herb layer (about 30%)well-drained; open pockets of bracken fern; polygon narrow band of white pine, spruce and cedarnatural pond or beaver pond? floating and submerged palnts; edges of flooded polygon are shrubs (dominated by Myrica gale and Alnus incana var. rugosa); water/forest edge slope very abrupt; water at edge about 1m deepmuch wetter than area near AA point 401 further west in this large polygon; leatherleaf in small "islands" not evenly distributed as in 401; very wet around "islands" with Menyanthes and Cladium; lot species diversitydry upland; east/west-running ravine about 20m north of point; lots of standing dead paper birch, some may have been in canopydry; cedar have stripped bark; sparse herb layer due to dense hemlock understorydry upland; recent blowdowns (canopy-sized Abies); old downed trunk of large yellow birch; lots of dead Taxus shrubs; canopy gaps; one huge emergent hemlock about 10m NE of AA point; canopy about 10% cover in canopy gapsdry upland; opening near AA point with downed trees and snapped tops (Abies?) with Acer spicatum; sparse herb layer; canopy trees near 20m tallnear edge of bluff; Pinus strobus is major canopy component only along edges and lobes extending outwell-drained; fair amount of poison-ivy on less vegetated areas; some Salix (<5%) and milkweed and jointweed (<5%); Eleocharis and grasses in low pockets of duneevidence of blowdown; some aspen snapped in half (new and old); bigtooth aspen tallest in canopywell-drained; some blowdown; area a mix of conifers and deciduous (mostly) trees; has some green ash and basswood but also pockets of hemlockat bank; Betula papyrifera and Betula alleghariensis along bedrock boundary; assessed only bedrock; rock margin is mostly Salix; short-shrub stratun ninebark most common all others <5%; all herbaceous stratum<5% except Solidgo and Campanula; rock cracks Salix and Betula papyrifera seedlings; some graminoids, Calamogrostis most common all <5%; dominant herbaceous species Solidgo canadensiswell-drained; multiple converging hills/valleys; minimal blowdown; cedar trees with shredded bark; sparse herb layer; sugar maple dominant in hardwood areasmesic woods; beach 15m to west and south; short-shrub stratum sparse; pockets of open area with bracken fern, Eurybia and graminoids; sparse vegetation on forest floorpoorly drained; wet pocket with hemlock, yellow birch and sugar maple on border of polygon; sphagnum around perimeter, center saturated; beaver evidence with downed trees and old damsmesic woods with small occasional pools of standing water; sparse understory; 10x20m inclusion about 10m NE of AA point (opening with leatherleaf, Ledum, Nemopanthus); large dbh white pines in polygon (1 about 28"); evidence of past logging (large stumps)_& wa$AbSA x Y\@ 2(.P(Y2i@APIS.AA505AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestAcer saccharum - Tilia americana / Ostrya virginiana / Lonicera canadensis ForestCEGL002458Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island15NAD833.5mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUpland@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak64:30maple, hemlock, cedar, oak, birchxYTTTHHHHHHH>>3( ~~~~~~a[[O _____VJE72EaF%ASA x YW@ d.( Yi@APIS.AA504AshlandSandstone Great Lakes Shore Cliff Sparse VegetationSandstone Bedrock Great Lakes Shore Sparse VegetationCEGL002507APISOuter Island15NAD839.7mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aChannel wallflatUpland@plant stemsCold-deciduousBroad-leavedSparse vegetation 1 - 2 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak611:20balsam fir, birch, maplex=;;!sffZZZZRRL>9-(" ____VJE12Exaj$ASA x Y`@ <.P<2Y<i@APIS.AA503AshlandTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APIS Oak Island15NAD8310.1mC. Groebner, N. MurphyModerate8 degreesEHigh slopeslopeUpland@#@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m!hemlock dominant with hardwoodsmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak62:00birch, maplexB@@2,*#}}unL?3''''   ______VJE12Űax{$APSA x YX@ P.F Yi@APIS.AA502AshlandCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISBasswood Island50215NAD837.2mC. Groebner, N. Murphy, B. DunlapGentle1 degreeVariableLowslopeflatUpland@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m:@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak69:01N - Pinus strobusx||qf[PPH:*  u"_____VJE76Ea@%A3SA x YX@ F.( YPi@APIS.AA501AshlandCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISOuter Island15NAD8310mC. Groebner, N. MurphyFlatFlat (n/a)LowslopeflatPalustrineSaturated@plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak69:45CEGL005044 - birch, maple, hemlockx?== zo_RRFFF;//)  ______VJE12Mx2LVAL V d VDj4bcanopy dominated by Betula papyrifera and Populus tremuloides; keys to CEGL002468 but could be CEGL002467oak dominant but walking through polygon on way to next point could give this a CEGL002468 (more aspen and birch)mix of aspen, spruce, balsam fir and birchdominants Pinus strobus and aspendeciduous type keys to CEGL002457; not enough Tsuga in canopy to be CEGL005044 (although could develop into it as subcanopy Tsuga reaches canopy size)canopy not dense with Pinus stobus and Picea with pockets of dense Thuja and Picea in subcanopy; toss up betweeen spruce and Thuja and went with spruce because it is in canopy and subcanopy; also red pine in canopy; second choice to acknowledge a significant amount of Thuja but this AA does not allow for pinekeys to 39B (sphagnum greater than 25%), but since not dominated by shrubs (or trees), it doesn't key beyond that; CEGL005277 closest fitmost red maple in subcanopy (approaching canopy size); canopy dominated by bigtooth aspen; keys to CEGL002466; possibly CEGL002468 after maples become tallerhemlock dominant with cedar understoryabout 30% decidudous in canopy so keys to CEGL002450; could also key to CEGL002449difficult polygon to name; dominated by Betula in canopy; less than 25% conifers in canopy; keys to deciduous typeHudsonia is about 30%, therefore keys to CEGL004024, but since near 25% requirement, CEGL005098 selected as second choicemore Pinus strobus in canopy at south end near GPS point and near bluff edge going north; toward north in polygon, canopy is Tsuga with Betula and scattered pines (this is most of the polygon)deciduous with stong component of red oak; ground 40% cover, seems enough for CEGL002461hemlock dominant with <25% deciduousCEGL002458 - has basswood and sugar maple with hemlock; CEGL005044 - if hemlock is more important than this is second choiceno good fit; CEGL002467 chosen because paper birch is dominant; CEGL002468 also chosen because of variety of trees even though found on west and north slopesb, 5xza %ASA x Y^@ <.<2Yk@APIS.AA510AshlandCEGL002598 - Tsuga canadensis - (Betula alleghaniensis) ForestPinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590Tsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISStockton Island71215NAD835mK. HiserGentle2 degreesWHigh slopeflatUplandf@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1062:11xcaaa[YO   uush``VVVVVRKGGBBBB%_____VJE76E0?at~$AmSA x Y@^@ ((.( Z i@ APIS.AA509AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS Long Island15NAD833.7mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland@plant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 m <0.5 m <0.5 mdominated by beachgrassmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak69:40alder, spruce, birchx"   uuuuuu^SC66****""______VJE12Ea<$A@VSA x YW@ P .P2YFi@APIS.AA508AshlandAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISBasswood Island50815NAD836.2mC. Groebner, N. Murphy, B. DunlapGentle4 degreesNWHigh slopeflatUplandb@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mkeys out easilymjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak63:26Cold-deciduous throughoutx<::zzrdTGG;;;;33-!!  ______VJE16Ea$A@.SA x Y\@ <.F( Y(i@APIS.AA507AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestQuercus rubra - Acer saccharum ForestCEGL002461Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISStockton Island15NAD8310.6mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland~@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1062:03x}{q3...""""""yyfffff_XTTTTTT711%_____VJE72E0?a"{$AISA x Y _@ F .P<(Y<i@APIS.AA506AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APIS Bear Island15NAD834mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatUplandM@adjacent paper birchplant stemsEvergreenNeedle-leavedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 mH@caterpillars eating leavesmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10612:20Paper birchx977*#!ujjbSH;    ______VJE120U ~ FkaP|$ASA x Y _@ 2.Z(FYi@APIS.AA514AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APIS Bear Island15NAD835mC. Groebner, K. HiserGentle2 degreesSEMidslopeslopeUplandR@ adjacent to maple-birch-cedarplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mL@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1061:40maple, birch, cedarx@>>)#!yWJ  ______VJE120a$AOSA x Y]@ 2.2Yi@APIS.AA513AshlandCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISIronwood Island06715NAD8310.3mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10611:38xJEEE999999/%%rrrrrkd``[[[[>88,_____VJE76E0?a$ASA x Y`@ 2.22(Y i@APIS.AA512AshlandCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Cat Island75415NAD835.3mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland@ plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1062:27xu7222&&&&&&}}jjjjjd]YYTTTT<66*_____VJE76E0?ab$A@6SA x Y ^@ <.(i@ APIS.AA511AshlandCEGL005098 - Ammophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationHudsonia tomentosa Dune Dwarf-shrubland [Provisional]CEGL004024Ammophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS Long Island08415NAD833.4mJ. Marr, K. HiserGentle2 degreesVariableHigh slopedune (undifferentiated)Uplanddryplant stemsEvergreenBroad-leavedDwarf shrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10512:16xpkkk______UKA6++++ yuuppppWQQE_____VJE76E?h <a$A@kSA x YZ@ F.(<(<<i@APIS.AA518AshlandPicea mariana/Pleurozium schreberi ForestCEGL002456 - Thuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestPicea mariana / Pleurozium schreberi ForestCEGL002447Thuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456APISStockton Island15NAD836.7mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatUplanda@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 ml@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak69:25spruce, cedarx}}}}}}si_TI>33+ztth____VJE72Eab$A@iSA x Y\@ Z.(Y @ APIS.AA517AshlandCEGL002282 - Potamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationNymphaea odorata - Nuphar lutea (ssp. pumila, ssp. variegata) Herbaceous VegetationCEGL002562Potamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationCEGL002282APISStockton Island - Quarry Bay38015NAD838.9mJ. MarrFlatFlat (n/a)Channel bedchannelLacustrinePermanently flooded@plant stemsPerennial herbBroad leaf herbaceousSparse vegetation 2 - 5 m 1 - 2 m <0.5 mx@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1057:30S - Red Pine/Abies Forested SlopexznnnnnnnnnddYNNNN;$iccW_____VJE76M@xa$ASA x YZ@  Z.(YFP @ APIS.AA516AshlandCEGL005229 - Carex lasiocarpa - (Carex rostrata) - Equisetum fluviatile Herbaceous VegetationChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Carex lasiocarpa - (Carex rostrata) - Equisetum fluviatile Herbaceous VegetationCEGL005229APISStockton Island01515NAD832.3mJ. MarrGentle2 degreesSELowslopeflatPalustrine@ 20% plant stems, 70% sphagnumPerennial herbGraminoidHerbaceous vegetation 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoOlympus64:20~50 m SW - Red Pine-Jack Pine Forestxzzzzzzpff[PPPP9.~~r _____VJE76EPxa$A@CSA x Y^@ F.< Y<i@APIS.AA515BayfieldCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS mainland50415NAD836.9mJ. MarrGentle3 degreesNWMidslopeslopeUpland@ plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m:@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoOlympus611:00Betula papyrifera-Acer saccharum Mixed Hardwood Foxwrrrffffff\RRG<1&&||p`````VJE76E07h V Oaw$AQSA x Y@^@ < .F Y(`i@APIS.AA523AshlandCEGL002467 - Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Populus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467APIS Long Island15NAD837.7mJ. Marr, K. HiserGentle2 degreesWMidslopeslopeUplanddryplant stemsCold-deciduousBroad-leavedForest 5 - 10 m 2 - 5 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1069:21E - 5098 (Ammophila dune community)x{{{{{{qgg\QF::2$y"_____VJE72E0an$AvSA x Y_@ <.Z< Y<`i@APIS.AA522AshlandQuercus rubra - Acer saccharum ForestCEGL002461APIS Oak Island15NAD838.5mC. Groebner, N. MurphyGentle5 degreesEHigh slopeslopeUplandK@)@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak611:45birch, maple, oak, aspenxuj_TTL>.!    ______VJE12ŐaL$ASA x Y\@ <.F2(Y `i@APIS.AA521AshlandPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISStockton Island15NAD832.1mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 1 - 2 m0.5 - 1 m <0.5 mT@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak65:45maple, birch, balsam firx.,,  ~~voM@@4444,,&______VJE12Ea$ASA x Y_@ <.<2(YZ`i@APIS.AA520BayfieldPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APISSand Point Road15NAD836.9mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandwell-drainedadjacent to cedar and birchplant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m15 - 20 m 2 - 5 m0.5 - 1 m <0.5 mB@ old road goes through polygonmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak61:45ash, cedar, birchxwuub\ZSre<""""``````VJE12Őa$A@-SA x Y`@ <.F22Yi@APIS.AA519AshlandAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISOtter Island77615NAD835.5mJ. Marr, K. HiserGentle2 degreesEMidslopeslopeUplands@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m,@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1062:34xzodd\N>11%%%%   ______VJE16E0?q  a(%A%SA x Y[@ F.( YP @APIS.AA527AshlandCarex(rostrata, utriculata)-Carex lacustris-(Carex vesicaria)Herbaceous VegetationCEGL002282? - Potamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationMixed Herbaceous Wet Meadow (map class)HWMPotamogeton spp. - Ceratophyllum spp. Midwest Herbaceous VegetationCEGL002282APISOuter Island15NAD834.2mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelflatPalustrineSaturated@plant stemsPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1069:55balsam fir, pine, maplex~~~~~~tjj_____H=-   y4/____VJE72M`axq$ASA x Y _@ 2.F222Y(  @APIS.AA526AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APIS Bear Island15NAD835mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mf@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10610:18cedar, balsam fir, paper birchxE@@@444444*   iiiiie^ZZZZZZA;;/_____VJE72E0a~$A/SA x YY@ <.(P( @ APIS.AA525AshlandCEGL002474 - Abies balsamea - Betula papyrifera / Diervilla lonicera ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Abies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APISRocky Island15NAD834.3mC. Groebner, N. MurphyFlatFlat (n/a)LowslopeflatPalustrineSaturated@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mmore balsam fir than ThujamjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak9:15CEGL002463 - balsam fir, birch, maplepkkkCCCCCCCC9.#  qqqqqkd``````F@@4_____VJE72MoaN$ASA x Y@c@  <.F( Y `i@APIS.AA524BayfieldThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island02115NAD8310mM. Smith, J. MarrGentle1 degreeN350LowslopeflatUpland2@20% plant stems, 40% mossesEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoCanon73:35xvkkcTI,,    ``````VJE16E0?LVAL R   l8BBall alder except for a few red maple around marginpine barrens but could be second choice of CEGL002520 because of some birchto key to CEGL005229, water needs to be >0.5m deep which it is not; description fits wellaspen and birch with hardwoods; balsam fir subcanopy dominantCarex-dominated; significant amount of dogwood could make it wet meadow with no dominant speciesdominant paper birch, hemlock and sugar maple with balsam fir and cedar in subcanopyDominant deciduous tree is Acer rubrum."woodland" less than 60% canopy coveroak dominant with paper birch and aspen in canopywet medow herbaceous mapclass; nothing dominant except maybe Calamagrostiseasy to key but because of presence of Alnus and Thuja CEGL002456 and CEGL002471 were harder to exclude; very similar composition to APIS.232, but taller trees with less coverage of Thuja and Alnusdeciduous; not enough Quercus for CEGL002461classic sugar maple - yellow birch forest2 community types in polygon - CEGL005098 and tree/shrub portion (paper birch dominant)best fit; less maple than adjacent polygon, not as dense canopylots of sphagnum; shrub-dominated wetland so keys to either CEGL002381 or CEGL005227; doesn't fit either description too well; Salix dominant at and near point; alder dominant SE of pointmore black sprunce than white pinekeys to CEGL005125 although there is no Pinus banksiana presentmixed deciduous-conifer forest (>25% cover of Abies in canopy); difficult to determine type; is there enough Abies in canopy for CEGL002474? there's no mention of Acer rubrum in CEGL002474 description; is there too much Abies for CEGL002457?deciduous-dominated in subcanopy with strong conifer component in subcanopy; primary = deciduous, secondary = mixed; not enough Quercus (between 10 and 20% cover) to be CEGL002461open water with scirpus most dominat but a mixed bag once again!dominant hemlock with birch and cedar/fir subcanopyfLVAL!  X  r # _ `w{N.KJstanding dead trees; sparse herb cover; recently snapped off Abies in castanding dead trees; sparse herb cover; recently snapped off Abies in canopy and subcanopy; canopy cover between 70 and 80% (less where blowdowns)well-drained; <5% Salix exigua; poison-ivy scattered throughout areaground saturated; no standing water; few tall white pine; sphagnum carpets much of polygonSmall stagnant pools of water present occasionally throughout plot. Lake about 100 m to east.well-drained; southern boundary Tsuga canadensis stand; herb layer mostly litter/duffArea greatly affected by blowdown event. Lakeshore about 100 m to north. Pocket of dense balsam fir. Openings of Calamogrostis canadensis.poorly drained; standing water; standing snags in standing water with islands of vegetation; AA point is taken at pond marginwell-drained; minimal blowdown; understory mostly blowdowns with moss and Thuja seedings; no herbaceous stratum, litter/duff due to dense balsam fir and cedarCliff bank between forest to west and lake to eastwet meadow with small channels of water running through; evidence of beaver activity; forested pockets in polygonmoderately drained; some blowdown; flooded swampy area with dead snags and blowdowns; paper birch and cedar around margin of polygonwet; patches of standing water; saturated soilpoorly drained; standing water; wet alder thicket; sparse understory due to dense alder and wet conditionswet; very little sphagnum seen; standing water; Utricularia intermedia in water-filled channelwell-drained; point is in drainage to lake; dry, no water; sedge and grass in drainage; sides of bank mostly litter/duff or thimbleberryopen pockets of sedges surrounded by tree canopy; wet saturated soil; snags and old blowdownsminimal blowdown, well-drained; lush understory with Taxus dominant; dominant free canopy is paper birch with hemlock and sugar maple; subcanopy is cedar and balsam firdry upland; recent and old blowdowns of cedar near point; lots of Taxus and litterwetland; no standing water; saturated soil; hummock/hollow microtopographywell-drained; forest floor mostly sugar maple seedlings/sparse, mostly litter/duff; some yellow birch in subcanopy <5%abandoned beaver pond; currently dry with a channel running through it (with mud but no standing water); many standing dead trees; areas of somewhat sparse vegetation; probably often floodedpoorly drained; dead cedar and spuce snags; mostly vegetated with saturated soil but no ponds; a mix of herbaceous spp. but nothing dominantwet, no standing water; canopy is just over 10m talldry upland; not much herb cover; moderate Taxus cover; lots of sugar maple regenerationrich mesic sugar maple forest; forest floor mostly sugar maple seedlings with oakferndry; dock, campground and picnic area in polygonbirch snags; mesic; open pockets with Solidago and Calamagrostiswetland; presently no standing water; channels; likely inundated in springwet; no standing water; sphagnum mat is dry; pockets of Carex and trees closing in bog; border to the west has oak seedlings <5%large tree-less opening in polygon with Cladina, Carex, Hudsonia, Vaccinium angustifolium; woodland physiognomy; dense shrub layerpolygon is mesic woods adjacent to beaver wetlands and pond; beaver-chewed stumps on east side of point; forest dominated by Abies, Acer rubrum, and yellow birch wraps around beaver ponddry site (at least now); herbivory on Taxuspoorly drained; standing water; open water has Brasenia schreberi <5% other carex spp. <5%; Chamaedaphne around western margin of water, also Impatiens capensis; <5% Dulichium arundinaceum along beaver runways and Calamogrostis on drier areas <5%) erAaZ4$ASA x Y^@ 22.(Z YP`i@ APIS.AA532BayfieldCEGL002381 - Alnus incana Swamp ShrublandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227Alnus incana Swamp ShrublandCEGL002381APIS York Island08215NAD836.3mJ. Marr, K. HiserFlatFlat (n/a)MidslopelowlandPalustrineSeasonally floodedL@30% plant stems, 20% mossesCold-deciduousBroad-leavedShrubland 2 - 5 m <0.5 m <0.5 mv@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1051:07CEGL005098 Ammophila Dune communityxoig]}}tjj^^XXEEEEE?844////`````VJE76May$A]SA x Y_@  F.2< < (d`i@APIS.AA531AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APIS Bear Island74215NAD836.9mC. Groebner, K. HiserFlatFlat (n/a)MidslopeflatPalustrine@20% plant stems, 50% sphagnumMixed evergreen - cold-deciduousMixedWoodland15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 mD@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10612:46Quercus, Acer, BetulaxXVV?86,_@@4444(("  ______VJE16E0a$A@SA x YZ@ (.( < `i@APIS.AA530AshlandPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125APISStockton Island02915NAD832.1mJ. MarrVariableHigh levelflatUpland@plant stemsEvergreenBroad-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m~@ trails and outhouse in polygon?@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoOlympus84:15E - Ammophila dune community (5098)xZTRI wwm_TGG;;;;33-!!______VJE16E8a6%AASA x Y Y@ <.< Y2`i@APIS.AA529AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISOuter Island52915NAD839.9mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflatUpland@S@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoOlympus51:22W - 2457 (Acer-Betula-Tilia Forest)xqlll``````VLLA6+  zsoojjjjPJJ>_____VJE76Űa$A@SA x Y`@ F.<(Y @APIS.AA528AshlandCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Cat Island52015NAD836.8mJ. MarrVariableMidslopeflatUpland-@plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m0.5 - 1 m <0.5 mf@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoOlympus512:15xb```YWN   }}ssssjjjjjd]YYTTTT<66*_____VJE76E0g?6 { 3aD$ADSA x Y^@ P.(<2k@APIS.AA537AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island73615NAD832.7mK. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturated6@ *@30% plant stems, 50% sphagnumEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10610:34xA???86,xmNB666+______VJE160?a$ASA x Y`@ .F(Y `i@APIS.AA536AshlandAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISOtter Island78015NAD836.9mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUplandY@ plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mX@ trail just to east of polygonmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F1066:10x$"""vk``XJ:--!!!!  ______VJE16E?a#A;SA x Y@`@ P .Z(YF`i@APIS.AA535BayfieldAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISMeyers Beach Trail15NAD833mC. GroebnerGentle5 degreesW282MidslopeslopeUplandW@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 5 - 10 m0.5 - 1 m <0.5 mR@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak62:40W - Red and white pinexyncc[M=00$$$$ ``````VJE12E0a$ASA x Ya@  2. Y`i@APIS.AA534AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISOtter Island78515NAD836.4mJ. Marr, K. HiserGentle1 degreeSEMidslopebeachUpland2@plant stemsPerennial herbGraminoidHerbaceous vegetation10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@@mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10512:19x  yybWG::....&&______VJE16E?a#ASA x Y@`@ (.2______VJE12Őa%ASA x Y^@ <.(Y2k@APIS.AA540Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISStockton Island72015NAD835.6mK. HiserFlatFlat (n/a)Midslopebeaver pondPalustrineIntermittently flooded@ plant stemsPerennial herbBroad leaf herbaceousHerbaceous vegetation 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 mmjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoFuji F10511:43x l\OOCCC+____VJE16M0y?a x Y .( Y APIS.AA539BayfieldNO DATA SHEETAPIS15NAD83plant stems <0.5 mJFDNO DATAyuuuuuuuooooooo````VJE#2a0/%A@SA x Y ]@ F.( YZi@ APIS.AA538Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD838.8mC. Groebner, N. MurphyFlatn/aFlat (n/a)n/aLowslopeflatPalustrine@ plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Photos, Opt3=Time of First PhotoKodak612:05spruce, balsam firxk`PCC7777++% ____VJE12Ex H aN$A@#SA x Y`@ (2.<<@plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:16CEGL002071, mostly A. rubrum w/ B. papyrifera,XvvvvvvvllaVVJJ3( }wwk`````VJE72ya%ASA x Ye@ F.P(225% cover Tsuga)mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1069:16Between AA.544 and AA.447 is birch-maple, mostlyxcaa/)'ttleC66****""______VJE16E0R  'aT%ASA x Y ]@ <.( Yi@ APIS.AA552Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD832.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatPalustrine@plant stemsPerennial herbBroad leaf herbaceousHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:20maple, spruce, firx0.. {dTGG;;;;//) ____VJE12E0xa %ASA x Y@]@ ( .FYP<`i@APIS.AA551AshlandCEGL002381 - Alnus incana Swamp ShrublandFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105Alnus incana Swamp ShrublandCEGL002381APISMichigan Island05615NAD838.3mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturated0@plant stemsCold-deciduousBroad-leavedWoodland15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10612:03x|zzzsqg)$$$zppdd^^KKKKKE>::5555_____VJE76Mp?a>$A)SA x Y\@ (.(<(Y `i@ APIS.AA550AshlandAlnus incana Swamp ShrublandCEGL002381APISStockton Island15NAD836.6mC. Groebner, N. MurphyFlatFlat (n/a)LowslopeflatPalustrineSaturatedl@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 md@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak65:30birch, maple, sprucex|rrg\\PPE7'}______VJE12Mya $ASA x YZ@ F.<2<`i@APIS.AA549AshlandCEGL002520 - Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589Pinus resinosa - Populus tremuloides / Diervilla lonicera - Vaccinium spp. ForestCEGL002520APISStockton Island15NAD836.5mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandwell-drained wetlands to west and Ammophilaplant stemsEvergreenNeedle-leavedForest15 - 20 m 5 - 10 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:55Wetlands, dwarf-shrubland (dune)xwll`UUM>3&nhh\ _____VJE72Őaz$ASA x Y`^@ ((.( <  @ APIS.AA548BayfieldCEGL002257 - Carex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCarex lasiocarpa - (Carex rostrata) - Equisetum fluviatile Herbaceous VegetationCEGL005229Carex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISmainland - Sand River39215NAD835.6mJ. MarrGentle1 degreeNWChannel bedchannelPalustrineSaturated`@@plant stemsPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m <0.5 m@d@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus612:15SEE COMMENTSxxmmmmmVK;." %`````VJE76PLVALp^ L \ NFsphagnum mat with tamarack and leatherleaffloating-leaved aquatic communityhemlock dominant but not by much; other hardwoods (oak, maple, birch) about equal in cover; second choice would be CEGL002457Quercus present (tallest) in canopy but not dominant (<40%); sugar maple canopy and subcanopy dominantbalsam fir dominant in understory but put in Pinus strobus classification as emergent dominantfits well, especially with floristic composition in descriptioncould classify as red maple forest or sedge open area (about 50:50)This Fraxinus stand had all ash no white cedar or Cornus sericea just Acer spicatum.dominated by juniper; assessed polygon strip between beachgrass and jack pie forestcanopy cover <60% cutoff for forest; keys to CEGL005271 otherwiseKeys out to dominant Populus/Betula with secondary vegetation association as well. Chose CEGL002468 as primary because stand had a fair amount of Acer rubrum and CEGL002466 called for Picea glauca - not Picea in stand.bigtooth aspen dominant; Acer spp. in subcanopyKeys out easily to Populus tremuloides forest.keys to CEGL002589 (no pine appeared to be dominant)mostly water with islands of Calamagrostis canadensis; <5% low shrubs on islands; muddy water with floating vegetationPinus strobus and Pinus resinosa along cliff ridge; rest of polygon is Thuja with a few Tsuga and Abies balsamea understory; Betula papyrifera instead of Betula alleghanisensisSparsely vegetated - keys out to bank. Narrow band between ridge and water - clay; erosion evidence.2 community types present in polygon (forest "islands" with red maple dominant with Abies) and beaver meadow with similar species in drainage to south of AA point (>25% cover of Calamagrostis canadensis)a mix of a few scrubs and herbaceous species; flooded area with dead snags; mucky water and no vegetation; wet meadow herbaceous mapclassdense alder with woodland amount of Fraxinus - CEGL002105 or CEGL002381?m" a qQaFn$ASA x Y ^@ < .< >8,,"````VJE16Ex/a7%A@SA x Y Y@ P.(YP`i@ APIS.AA553AshlandCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174APISOuter Island55315NAD837.9mJ. Marr, B. DunlapFlatFlat (n/a)Channel bedchannelPalustrineSaturateds@4@ plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:37Mixed conifer-deciduous around pointxCAA {p`SG;;;0$$______VJE16xh 5a^$ASA x Y ^@  <. ( <(i@ APIS.AA562AshlandJuniperus horizontalis - Arctostaphylos uva-ursi - Juniperus communis Dune Dwarf-shrublandCEGL005064APIS Long Island15NAD832.3mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatUplandF@plant stemsEvergreenNeedle-leavedDwarf shrubland 2 - 5 m <0.5 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:40Jack pine, beechx~~m^SFF::::22,!!______VJE12Ea$ASA x Y\@ 2.2YFPi@APIS.AA561AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD835.7mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturated\@20% plant stems, 30% sphagnumEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1061:42x*(((" peFF:::/##______VJE12M0?a$ASA x YW@ P .F2733....````VJE16Et ) ka‡$A(SA x YY@ ((.2F(Yi@APIS.AA567AshlandPinus strobus / Vaccinium spp. ForestCEGL002444APISDevils Island15NAD832.7mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandZ@plant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:20CEGL002447 - birch, spruce, fir, aspen   yoodYNCC;,!______VJE12E0a%ASA x Y^@ <.F(Y k@APIS.AA566AshlandTsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island71415NAD836mK. HiserGentle2 degreesVariableHigh slopeflatUplandabout 3m from edge/bluff; dryplant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m~@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:59xwh]PP%%%%  ______VJE16E0?a~A%A@rSA x YX@ .(( YP  @ APIS.AA565AshlandWet meadow mixed herbaceous mapclassCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174Mixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD834.8mC. Groebner, N. MurphyFlatFlat (n/a)ToeslopedrawPalustrineSaturated@plant stemsCold-deciduousBroad-leavedWoodland 5 - 10 m 2 - 5 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:15CEGL005245 - birch, maplexpnnSLJC}qqkaaUUOO777771*&&&&&& _____VJE72M0a( $ASA x Y@W@ F .F < YFi@ APIS.AA564BayfieldFraxinus nigra - Mixed Hardwoods - Conifers/Cornus sericea/Carex spp. ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island56415NAD8310.0mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturated*@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@ @mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:01 AMS and W - Populus tremuloidesx|>9--!!!!!!! yogeBBBBB;400++++    ````VJE16Ma`#A@SA x Yc@ < .FY i@APIS.AA563BayfieldThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island04115NAD838.1mJ. Marr, M. SmithVariableMidslopeflatUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon711:52x}rg\\TM+  ``````VJE16E0?LVAL x d v % u tu4guYwet opening with some standing water/small stream; surrounded by forest; extensive beave workings; old dam south of point; beaver-chewed stuwet opening with some standing water/small stream; surrounded by forest; extensive beave workings; old dam south of point; beaver-chewed stumps; old dam overgrown with Rubus and red maple; shrub-sized red maple and yellow birch; emergent grass/sedge hummocks in water and near shorepoint is just west of dock; trees and shrubs line upper edge of beachgrass community (paper birch, red maple, red pine) 5-10m tallwet polygon with patches of standing water and open water in middle; due south of AA point is old beaver dampoorly drained; small stream present; flowing stream through polygon with old beaver dams; beaver ponds with dams and dead snags; Impatiens and Rubus dense on dams; a few pockets of Iris versicolor (<5%)well-drained; minimal blowdown; dense canopy, sparse understorywet; hummock/hollow microtopography; ericaceous shrub/sphagnum-dominated wetland; few herb species with scattered trees (taller trees near wetland edge)well-drained; many blowdowns in this cedar swamp; pockets of standing water between sphangum moundswet/saturated to mostly dry alder thicket; mostly above bog mat; very little herb layer due to leatherleafsmall areas of wetland pockets; small old duen to northeast of point, runs SE to NW parallel to shore; slope about 5 degrees, <2m high; southern edge of polygon is narrow band of trees (Quercus, Betula papyrifera)dry but likely often wet/saturated soil; many pockets and hummocks; very soft grounddry upland; snapped off Abies (subcanopy); downed paper birch trunks; lots of sugar maple regenerationdry upland; lots of cedar down (some recent so aerial photo shows more in canopy and subcanopy); also downed Abies and Betula (not recently); lots of sugar maple regenerationhighly eroded open bank; standing dead paper birch; areas of bank are sparsely vegetated, others are densely covered with Thuja, Abies, Betula shrubby trees (5-10m tall); 4m wide cobble/boulder beach in polygonwell-drained; minimal blowdown; sparse to no understory due to dense tall-shrub layer of Abies and Thuja; trail is to the east with some Taxus (<5%)poorly to moderately drained; narrow west-facing polygon; very wet with standing waterpolygon is narrow strip of "high" ground in Stockton Tombolo lagoon wetland complex; along eastern edge is water-filled channel with Nymphaeadry to saturated alder; borders woodland to north and bog mat to south; some bog species within alder thicket but <5%dry; mostly beachgrass with some short Acer and Pinus (shrub size trees); good amount of Artemisia throughout polygonpoorly drained; 60% water; beaver dam ponds with standing snags; Taxus on pond margins; some bulrushes (<5%); 4 or 5 individual ponds holding waterwell-drained; narrow strips of land between beach and dune community; 80% beachgrass, <5% Lathyrus, rest of vegetation Prunusaquatic; lagoon surrounded sedge fen of Carex lasiocarpa, Cladium mariscoides (on small "islands" in lagoon)well-drained; substantial amounts of hardwoods but also pockets of dense hemlock with subcanopy and shrub layers represented; sparse understory, mostly litter/duff with sugar maple seedlingsmajor blowdown; moderately well-drained; a mix of moss mat and dry areas of pine needlesmoderately drained; little standing water; wet saturated pockets with sedges and grasses; Salix concentrated in northern end with Calamagrostis; west side has tree encroachment; beaver evidence with drained pondsmesic woods with pools of stagnant waterc 0{a$ASA x Y@W@ (.(YZi@APIS.AA572BayfieldCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCalamagrostis canadensis - Phalaris arundinacea Herbaceous VegetationCEGL005174APIS Sand Island57215NAD835.8mC. Groebner, N. Murphy, B. Dunlap1Gentle1 degreeVariableHigh slopeflatPalustrineSaturated wet meadowplant stemsPerennial herbGraminoidHerbaceous vegetation 1 - 2 m <0.5 mB@f@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak79:01 AMN-Populus tremuloides; E-Alderxrig`"|ppf\TR/////)"````VJE16M`a&$ASA x YZ@ F.<(FYd @APIS.AA571AshlandLarix larcina/Alnus incana ForestCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestLarix laricina / Alnus incana ForestCEGL002471Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD838.7mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrinemoderately drainedplant stemsEvergreenNeedle-leavedForest10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mT@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak4:15Tamarack, balsam firxwwwwwwmccXMMBB:+ qkk_____VJE72Eyoa %ASA x Y@]@ d.( Yi@APIS.AA570AshlandNymphaea odorata - Nuphar lutea (ssp. pumila, ssp. variegata) Herbaceous VegetationCEGL002562APISMichigan Island06115NAD835mJ. Marr, K. HiserFlatFlat (n/a)MidslopelagoonLacustrinen@plant stemsPerennial herbBroad leaf herbaceousSparse vegetation <0.5 mB@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F105NAxzcSFF::::..&  ______VJE16E@?a|$ASA x Y`@ <.ZF210% but still keys to CEGL002584Quercus rubra is dominant but just barely; second choice without Quercus dominant would be aspen - birch - coniferalder dominant with Myrica gale and Salix spp.paper birch and white pine also presentsome leatherleaf present (about 10-30 cm tall), dwarf Myrica; graminoid-dominated wetland; fits CEGL005228 to a point but needs more leatherleaf to key out; could be CEGL005229 (since may be dominated by Carex exilis for this type)alder thicket has understory of leatherleaf and Myrica gale with some sphagnumjack pine woodland, most Quercus appears to be in subcanopy but nearing canopy size; keys to CEGL002441 (with 20% Quercus in canopy), however, CEGL002478 fits betterno pond vegetation; 30% mix of Carex, Scirpus and herbaceous species along margins and on damsonly beachgrass - no other grasses, Carex or shrubs; <5% Prunus pumilaKeys out to herbaceous grassland.h ' kas$A?SA x Y@^@  < .2 (Y(i@APIS.AA576AshlandCEGL002441 - Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestPinus banksiana - (Pinus resinosa) - Quercus ellipsoidalis / Carex pensylvanica ForestCEGL002478Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002441APIS Long Island69015NAD833.7mJ. Marr, K. HiserModerate9 degreesSWHigh slopedune (undifferentiated)Upland dry, sandy;plant stemsMixed evergreen - cold-deciduousMixedWoodland15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mJ@trail through polygong@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1061:18SW - alder thicketx yyyyyyyoodYNCC92{{{{b\\P_____VJE76E8a/%AMSA x YY@ F. ( Y2i@APIS.AA575Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD836.3mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturated@plant stemsPerennial herbMixedHerbaceous vegetation10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:50CEGL002466-birch, maplex!}}f_OBB666+____VJE12MyaL#AOSA x Yc@]<.F(<Y @APIS.AA574BayfieldCEGL002450 - Thuja occidentalis - Betula alleghaniensis ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS mainland05715NAD839.1mJ. Marr, M. Smith2Gentle2 degreesW280slopeUplandlots of Abies near 5m tallplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mp@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon79:42xWRRFFFFFFF<22'wubbbbb\UQQLLLL600$`````VJE76E?a%%ASA x Y[@ 22.( Zi@APIS.AA573AshlandAmmophila breviligulata-(Schizachyrium scoparum) Herbaceous VegetationCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISOuter Island15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflat/beachUpland@plant stemsPerennial herbGraminoidHerbaceous vegetation <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:25CEGL005228x}}}}}}f[K>>2222** UI____VJE72E $ |an$ASA x Y@^@ P. F2Yi@APIS.AA581AshlandAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APIS Long Island15NAD839.1mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturatedX@ plant stemsCold-deciduousBroad-leavedShrubland15 - 20 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m\@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:30Cedar, birch, maplex+))  ~~seUHH<<<1%%______VJE12Ma$A@zSA x Ye@22(ZFZk@APIS.AA580AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island580APIS15NAD834mJ. Grochowski, T. Gostomski2Gentle1 degreeVariableBasin floordepressionPalustrineSaturatedblack spruce - tamarack bogplant stemsEvergreenNeedle-leavedWoodland15 - 20 m10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m0.5 - 1 m <0.5 mN@y@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus52:12xusssmkb$```UII=00&______VJE16M?a$A@SA x YZ@  F.((<2i@APIS.AA579AshlandCEGL005229 - Carex lasiocarpa - (Carex rostrata) - Equisetum fluviatile Herbaceous VegetationChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228Carex lasiocarpa - (Carex rostrata) - Equisetum fluviatile Herbaceous VegetationCEGL005229APISStockton Island01815NAD832.1mJ. MarrFlatFlat (n/a)Low levelflatPalustrine@ 20% plant stems, 50% sphagnumPerennial herbGraminoidHerbaceous vegetation0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoOlympus88:30W-White and red pine; E-lagoon arm with Nymphaeaxzuuuiiiiii_UK@@@@@)xrrf_____VJE76EPa$ASA x Y`^@ F.(< i@ APIS.AA578BayfieldAlnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APISSand River wetland area15NAD833mC. GroebnerFlatFlat (n/a)Low levelflatPalustrineSaturatedw@60% plant stems, 10% sphagnumCold-deciduousBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:31S - Bog mat and tamarack; N - Pine/birchxOMM#wgHH<<<1%%``````VJE12Ma{$A@SA x Y_@ (( .( YZi@APIS.AA577AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS Bear Island74015NAD834.9mC. Groebner, K. HiserGentle2 degreesVariableMidslopebeachUplandw@plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mbeachgrass dominantD@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10511:21Pinus spp and Acer spp.xWUU<53)laQDD888800) ______VJE16Eyl ua4$ASA x Y\@ <(.ZYP @APIS.AA590AshlandCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata / Carex oligosperma / Sphagnum spp. Poor Fen Dwarf-shrublandCEGL005277Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD834.6mJ. Marr, K. HiserFlatFlat (n/a)Channel bedchannelPalustrineSaturated@20% plant stems, 20% sphagnumEvergreenBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mh@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1053:58xzppeZNCC8*tnnb _____VJE72M?a49%A@SA x YX@ ( (.(FF(YP @APIS.AA589AshlandCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISOuter Island15NAD837.9mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatPalustrineSaturatede@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mless than 25% deciduous covermjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak63:10CEGL005044-balsam fir, cedar, hemlockxVVVVVVLBB7,!yyyyyslhhhhhhNHH<_____VJE72Ma$ASA x Y`^@ < . (<<i@ APIS.AA588BayfieldCEGL005227 - Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandAlnus incana Swamp ShrublandCEGL002381Alnus incana - Salix spp. - Betula pumila / Chamaedaphne calyculata ShrublandCEGL005227APISSand River wetland area15NAD833mC. GroebnerModerate15%SW210MidslopedepressionPalustrineSaturatedl@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:00N-Birch, pine woodland; S-BogxVQQQEEEEEEE;1&{{{{{wpllllllGAA5`````VJE72Mas$A@&SA x Y@^@ < .(F(Yi@APIS.AA587AshlandAlnus incana Swamp ShrublandCEGL002381APIS Long Island68915NAD834.2mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrine@`@"plant stemsCold-deciduousBroad-leavedShrubland 2 - 5 m0.5 - 1 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10612:54N-Treed with Quercus, P. banksiana, P. tremuloidesxrmmmmmmmmmmccXMMMMB4$ }______VJE160xA bYa~8%AsSA x YX@ P .( YF(i@ APIS.AA595Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island59515NAD837.8mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelbeaver pondPalustrineSemipermanently flooded@&@#plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m 1 - 2 m <0.5 m <0.5 mX@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak119:50Mixed conifer-deciduous (dom. A. rubrum and Tsuga)xnll82.'|ocWWW>22%____VJE160xa$A@YSA x Y\@ P  .(Yi@ APIS.AA594AshlandAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISStockton Island38115NAD837.9mJ. Marr, K. HiserGentle1 degreeSMidslopebeachUpland@plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 1 - 2 m0.5 - 1 m <0.5 m easy to keymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10510:15x zzcXH;;////''  ______VJE16E4y?a"$AdSA x Y\@ 2.( YF2i@APIS.AA593AshlandCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APISStockton Island15NAD83J. Marr, K. HiserFlatFlat (n/a)Channel bedchannelPalustrineSemipermanently floodedn@plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1055:24x+)))#!|l__SSS:..%  ______VJE12MPx?a2%A@bSA x Y Y@  P. ( YZ @ APIS.AA592AshlandWet meadow mixed herbaceous mapclassCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257Mixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD834.6mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturated@plant stemsPerennial herbGraminoidHerbaceous vegetation 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mr@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10612:10CEGL002467-spruce, birch, aspenxunlb$  tthhbbJJJJJD=999999_____VJE72Mya^+$AWSA x Y[@ 2(.F(Y i@APIS.AA591BayfieldPinus strobus-Tsuga canadensis Great Lakes ForestPinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590APISLittle Sand Bay15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatUplandA@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 1 - 2 m0.5 - 1 m <0.5 m <0.5 mr@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:35maple, yellow birchxXVVA:81qddXXXXPPJ>9-(" ````VJE12E @ @ @ @ @@@@@@@@@@@@@@@J^bokYbMJbJksJ`fkWioL^JbO4^bokYbMJbJksJ`fkWioL^JbO5^bokYbMJbJksJ`fkWioL^JbO=^bokYbMJbJksJ`fkWioL^JbO=^bokYbMJbJksJ`fkWioL^JbO?^bokYbMJbJksJ`fkWioL^JbOG^bokYbMJbJksJ`fkWioL^JbOL^bokYbMJbJksJ`fkWioL^JbOM^bokYbMJbJksJ`fkWioL^JbON^bokYbMJbJksJ`fkWioL^JbOT^bokYbMJbJksJ`fkWioL^JbO[^bokYbMJbJksJ`fkWioL^JbO]^bokYbMJbJksJ`fkWioL^JbOf^bokYbMJbJksJ`fkWioL^JbOg^bokYbMJbJksJ`fkWioL^JbOm^bokYbMJbJksJ`fkWioL^JbOn^bokYbMJbJksJ`fkWioL^JbOs^bokYbMJbJksJ`fkWioL^JbO{^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg0``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg2``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg5``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg6``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg>``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg>``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgF``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgF``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgN``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg_``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgm``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgt``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgt``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgy``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg}``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbg]@@ @@@@@ @@ J``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgJ``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgJ``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgLQmo^JJ^^QUWJbYQbkYkJMQikJMMWJio`fYMQJU^JoMJSdiQkm'fidqYkYdbJ^*_LQmo^JJ^^QUWJbYQbkYkJMQikJMMWJio`fYMQJU^JoMJSdiQkm'fidqYkYdbJ^*_:LQmo^JJ^^QUWJbYQbkYkJMQikJMMWJio`fYMQJU^JoMJSdiQkm'fidqYkYdbJ^*_LQmo^JJ^^QUWJbYQbkYkJMQikJMMWJio`fYMQJU^JoMJSdiQkm'fidqYkYdbJ^*_LQmo^JJ^^QUWJbYQbkYkJMQikJMMWJio`fYMQJU^JoMJSdiQkm'fidqYkYdbJ^*_LQmo^JJ^^QUWJbYQbkYkJMQikJMMWJio`fYMQJU^JoMJSdiQkm'fidqYkYdbJ^*_LQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkm!LQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkm6LQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmdLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmxLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJJLYQkLJ^kJ`QJSdiQkmMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbk6MJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkGMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkNMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkQMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkQMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkVMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbk^MJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbktMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkMJ^J`JUidkmYkMJbJOQbkYkfWJ^JiYkJiobOYbJMQJWQiLJMQdokqQUQmJmYdbkMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{"MJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{;MJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{BMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{FMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{GMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{RMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{TMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{oMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{sWQiLJMQdokqQUQmJmYdb{s[@@@@@@@@@ MJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{}JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{JiQu^JkYdMJifJMJiQuidkmiJmJQhoYkQmo`S^oqYJmY^QWQiLJMQdokqQUQmJmYdbKJiQu^JkYdMJifJMJiQuidkmiJmJQhoYkQmo`S^oqYJmY^QWQiLJMQdokqQUQmJmYdbKWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOg1WJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOg5WJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgGWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgKWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOg[WJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgiWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgxWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJ`viYMJUJ^QMJiQu^JkYdMJifJOsJiSkWioL^JbOgWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/WJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/WJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/ WJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/ WJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/2WJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/8WJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/;JMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/;F @ @@ @ MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/CMWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/bMWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/cMWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/sMWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/MWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/QidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdb7QidOYbUM^JvLJb\kfJikQqQUQmJmYdbDQidOYbUM^JvLJb\kfJikQqQUQmJmYdbFQidOYbUM^JvLJb\kfJikQqQUQmJmYdbYQidOYbUM^JvLJb\kfJikQqQUQmJmYdb`QidOYbUM^JvLJb\kfJikQqQUQmJmYdbnQidOYbUM^JvLJb\kfJikQqQUQmJmYdbuQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbQidOYbUM^JvLJb\kfJikQqQUQmJmYdbSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmC:SiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCRSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmC[SiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmC`SiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCcSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCSiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCokkQiYMQJMJiQukffSdiQkmCP@  @ @ @ @ @ @@SiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCWoOkdbYJmd`QbmdkJOobQOsJiSkWioL^JbO'fidqYkYdbJ^*{(WoOkdbYJmd`QbmdkJOobQOsJiSkWioL^JbO'fidqYkYdbJ^*{WoOkdbYJmd`QbmdkJOobQOsJiSkWioL^JbO'fidqYkYdbJ^*{YbmQiOobJ^sQm^JbOb[obYfQiokWdiYxdbmJ^YkJiMmdkmJfWv^dkoqJoikY[obYfQiokMd``obYkOobQOsJiSkWioL^JbOc;[obYfQiokWdiYxdbmJ^YkJiMmdkmJfWv^dkoqJoikY[obYfQiokMd``obYkOobQOsJiSkWioL^JbOc;"[obYfQiokWdiYxdbmJ^YkJiMmdkmJfWv^dkoqJoikY[obYfQiokMd``obYkOobQOsJiSkWioL^JbOc;8[obYfQiokWdiYxdbmJ^YkJiMmdkmJfWv^dkoqJoikY[obYfQiokMd``obYkOobQOsJiSkWioL^JbOc;K[obYfQiokWdiYxdbmJ^YkJiMmdkmJfWv^dkoqJoikY[obYfQiokMd``obYkOobQOsJiSkWioL^JbOc;[obYfQiokWdiYxdbmJ^YkJiMmdkmJfWv^dkoqJoikY[obYfQiokMd``obYkOobQOsJiSkWioL^JbOc;^JiYu^JiYMYbJJ^bokYbMJbJSdiQkm'^JiYu^JiYMYbJJ^bokYbMJbJSdiQkm^JiYu^JiYMYbJJ^bokYbMJbJSdiQkm^JiYu^JiYMYbJJ^bokYbMJbJSdiQkm^JiYu^JiYMYbJJ^bokYbMJbJSdiQkm^JiYu^JiYMYbJJ^bokYbMJbJSdiQkm`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk!`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk'`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk0`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk:`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk>`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk?`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkA`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkA`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkB`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkC`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkG`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkQ`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkT`YuQOWQiLJMQdoksQm`QJOds`JfM^JkkY`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk]`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk]`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkkm`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkko`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkkq`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkkq`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkkx`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkky`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk}`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkk`YuQOWQiLJMQdoksQm`QJOds`JfM^Jkkbv`fWJQJdOdiJmJbofWJi^omQJkkffo`Y^JkkfqJiYQUJmJWQiLJMQdokqQUQmJmYdbKbv`fWJQJdOdiJmJbofWJi^omQJkkffo`Y^JkkfqJiYQUJmJWQiLJMQdokqQUQmJmYdbKfYMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?fYMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?6@ @ @ @ fYMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?1MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?JMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?WMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?bMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?fMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?yMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?{MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?|MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?MQJ`JiYJbJf^QoidxYo`kMWiQLQiYSdiQkm(MQJ`JiYJbJf^QoidxYo`kMWiQLQiYSdiQkmWMQJ`JiYJbJf^QoidxYo`kMWiQLQiYSdiQkmMQJ`JiYJbJf^QoidxYo`kMWiQLQiYSdiQkmMQJ`JiYJbJf^QoidxYo`kMWiQLQiYSdiQkmbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGJbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbG_bokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbG|bokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLok[obYfQiokWdiYxdbmJ^YksddOQOWQiLJMQdokqQUQmJmYdbGbokLJb\kYJbJfYbokiQkYbdkJhoQiMokQ^^YfkdYOJ^YkMJiQufQbkv^qJbYMJSdiQkmGlbokLJb\kYJbJfYbokiQkYbdkJhoQiMokQ^^YfkdYOJ^YkMJiQufQbkv^qJbYMJSdiQkmGbokLJb\kYJbJfYbokiQkYbdkJhoQiMokQ^^YfkdYOJ^YkMJiQufQbkv^qJbYMJSdiQkmGGLVAL: j & t `(h^ CEGL002450 - mostly Thuja but enough yellow birch for this AAnothing dominant except the water without any floating or submerged vegetation; second - if later in season with some floating-leaved aquatics, it could fit into CEGL002282alder (dominant) thicket is dry with black raspberry (dominant) understory with open pockets of Spiraea and Myrica gale; best fit; no sphagnumupland cedar-dominanted; >70% of canopy with Abiesdeciduous swamp forest (woodland?) with Fraxinus nigra (mostly in subcanopy); Fraxinus >25% cover so keys to either CEGL002071 or CEGL002105 (description fits better)easy to key; fits well (but could key to CEGL002467 if presence of birch species is emphasized)appears to have enough Hudsonia and little enough grasses and other species to key to CEGL004024keys to 45B (tree canopy >25%) woodland (30%) and 49A (Larix >25% cover); alder not seen so keys to CEGL002571CEGL002450 - still enough birch to use this AAeasily identified; best fit; Thuja dominantTwo vegetation types present, nearly equal in dominance, but more Alnus incana so chose Alnus incana Swamp Shrubland for primary association.Confident that association was keyed properly; no questions during keying process.mix of shrubs on sphagnum mat with standing water on mat and where Myrica gale is presentseveral canopy tree species (Picea mariana, Pinus strobus, etc.) are taller than the rest at about 30% cover; dense subcanopy with lots of cedar; difficult to key, closest type is CEGL0024562 community types present - CEGL002381 (nearest AA point) and graminoid mix (farther south of point)Keys out easily to yellow birch forest.almost equal amounts of red maple and hemlock; small pockets of sedges with flowing stream surrounded by red maple-hemlock; large white pine on margins; second choice gives dominance to hemlockkeys out easily to sparsely vegetated sandstone bedrockeasily classified as beaver-disturbed meadowLVAL | )  bePtB~8]Mesic woods, evidence of standing water that hasMesic woods, evidence of standing water that has dried or evaporated. Slight evidence of blowdown.well-drained; dense herbaceous layer with mostly Lycopodium and bracken fern with hazelnut and balsam fir shrub layerwell-drained; very little blowdown; sparse understory; all herbs <5%well-drained; blowdown; eroding and/clay bank with small rocks on beach; all herb species listed less than 5%; most common are Aster and Solidago species; paper birch and white pine on perimeterEvidence of blowdown. Mesic woods with small occasional pools of stagnant water.dense sphagnum layer; moist soil; standing water in placessaturated soil; patches of muck; standing dead trees (cedar?); beaver pond?well-drained; major blowdown; no herb layer of significance due to dense Taxus shrubspoorly drained; standing water; beaver pond with grass and sedge border; mostly water with no vegetation; sphagnum mat on northern end with cranberry dwarf-shrubs; along margin tall-shrub red maple; <5% Picea and Thujamoderately drained; some dead and dying alderwet with standing water and saturated soil; standing dead trees (birch, cedar); lots of dead and downeddry upland; large patches of Sambucus in areasandy; good drainage; patches of sand without vegetation; rolling topographydry; no standing water, but soil probably usually saturated; very dense shrub layers (blueberries); hummock/hollow microtopography; scattered trees; some areas more open with no trees; sphagnum species include Sphagnum fallax and Sphagnum magellanicumwell-drained; major blowdown; dense understory of Taxus, so very little herb layer; mostly litter/duff; canopy dominated by Thuja with a mix of fir, spruce and birchwet, no standing water but some very wet mucky pockets; hummock/hollow microtopography; canopy is just over 15m tallsome blowdown; mostly fern understory; rest of herb layer <5% coverwell-drained, minimal blowdown; old-growth hemlock, some hemlock seedlings, understory sparse under hemlock stands, otherwise Taxus and Acer spicatum dominant in open areas with yellow birch aboveBeach 20m to north, forest to east, west, and south of UTM point. Stream outlet on west side of plot. Cirsium spp. present possible non-native - too early to i.d. Beaver evidence (chewing and creek edge of polygon has remnants of lodge). Low area runs through polygon = old creek route. Dune community between polygon and beach north edge. Sedge opening NW corner. Myrica small pocket west edge and along creek.wet, saturated; standing water; dense Myrica gale and alder; hummocks of sedges; dense alder thicket with Carex understory; some Cornus and MyricaMesic forest. Dense balsam fir pockets 0.5 - 5m in height. Standing water pocket on east boundary. Hawkweed - fair amount in open areas. Blowdown pockets of fir and spruce - old not recent.saturated soil in low areas; no standing water; hummock/hollow microtopographypoorly drained; seasonally flooded; lots of graminoidsLake bordering north and west of plot. Standing water in places. Taxus canadensis very dense, going east browsed with very few needles. One Fraxinus americana in canopy. Point on west edge of plot looks east. A fair amount of large-dbh Betula alleghaniensis.moderately drained; some standing water; flowing stream goes through tree-covered area of red maple and hemlock; open area with sedges and grassesrocky lakeshore on northeast side of island; sparse vegetation; shrubs and herbs in cracks and crevices in sandstone shelf; sandstone boulders between shelf and forest; shelf about 1-2m above lake; bryophytes (Grimmia?) growing on sandstone shelf; standing water in shallow depressions; forest edge is paper birch (dominant) with balsam fir and red mapleZ &a $A%SA x Yc@z F.2 2 Y2(i@APIS.AA600BayfieldFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APIS Sand Island05415NAD8310.1mJ. Marr, M. Smith2VariableLowslopedrainagePalustrineSeasonally flooded8@20% plant stems, 50% sphagnumCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon79:18x,***$"rSSGGG3''   ``````VJE16M0?a #AiSA x Y`c@ ( 2.(F YPi@ APIS.AA599BayfieldWet meadow mixed herbaceous mapclassAlnus incana Swamp ShrublandCEGL002381Mixed Herbaceous Wet Meadow (map class)HWMAPIS Sand Island03015NAD837.5mJ. Marr, M. SmithFlatFlat (n/a)Basin floordepressionPalustrineplant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoCanon712:00x zj]]]]]]QQE88,,&& `````VJE760?a $AgSA x YW@ F.<(88,_____VJE76E0?a#A%SA x YV@ (.2<Y`i@APIS.AA603BayfieldPopulus tremuloides - Betula papyrifera - (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach60315NAD839.8mJ. Marr, B. Dunlap, C. Groebner1Gentle1 degreeFlat (n/a)High slopeflatUpland@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak612:31 PME-steep ravine with streamxvtm/***  yogeDDDDD>733....````VJE16Ea (%A SA x Y[@  P.( P2Zi@APIS.AA602AshlandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISOuter Island15NAD837.2mC. Groebner, N. MurphyFlatFlat (n/a)Low levelflatPalustrineSaturatedpoorly drainedplant stemsEvergreenBroad-leavedDwarf shrubland 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:25wetland, birchx0..zlaTT888-!!______VJE12Ma$ASA x Y\@ F .< Y(< @APIS.AA601AshlandCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD835.5mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturatedP@plant stemsMixed evergreen - cold-deciduousMixedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m|@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1063:24N-Cedarx{{{{{{qgg\QE::0)tnnb_____VJE72M0Z h 3ab$A@@SA x Y^@ 2  .FPY  @APIS.AA610BayfieldCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APISRaspberry Island15NAD833.6mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland@ plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m\@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:00cedar, birch, maplexNIII======3))nnnnnha]]]]]]?99-`````VJE72Ea$A@\SA x Y^@ . <Y( k@APIS.AA609AshlandAlnus incana Swamp ShrublandCEGL002381APISStockton Island73715NAD837.1mK. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturatedv@ plant stemsCold-deciduousBroad-leavedShrubland15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m easy to keymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10611:20x~tti^RGG<.}______VJE16M?a|$ASA x Y X@  (.F Y<i@APIS.AA608AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISManitou Island15NAD8310mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandE@ plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mV@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:56CEGL002457 - Sugar maplexNIII=======33(xxxxxslhhhhhhLFF:_____VJE72Ea"$A SA x Y]@ 2(.P(( Aa#A@SA x Ya@ F .F2(Y2k@APIS.AA615BayfieldCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS15NAD836mU. GafvertGentle6%WslopeUplandplant stemsEvergreenNeedle-leavedForest10 - 15 m 1 - 2 m0.5 - 1 m0.5 - 1 m <0.5 md@n@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoLumix64:01xHFFF@>7wwwwwwoohhhfbZZNNNNNJC???????99-`````VJE29?a!%ASA x Y@]@ (.(2< Y<(i@APIS.AA614AshlandCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISMichigan Island05515NAD8311mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturatedi@plant stemsCold-deciduousBroad-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m <0.5 m <0.5 mL@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F106NAN-Betula, A. rubrumxzuuuiiiiii_UUUJ>33) tnnb _____VJE76Mpar$A&SA x Y`@ <.P 2Y(k@APIS.AA613AshlandAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Cat Island76715NAD836.1mK. HiserFlatFlat (n/a)MidslopeflatUpland/@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@ N@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:36xvk`UUM?/""______VJE16E0?a$ASA x YZ@ < .( ( i@ APIS.AA612AshlandCEGL005098 - Ammophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationHudsonia tomentosa Dune Dwarf-shrubland [Provisional]CEGL004024Ammophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APISStockton Island02515NAD832.5mJ. MarrGentle3 degreesNWMidslopeslopeUplandN@ plant stemsEvergreenBroad-leavedDwarf shrubland 5 - 10 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus82:07E-Ammophila dune community; W-Pine Barren-likexLGGG;;;;;;1'}yyttttWQQE_____VJE76Ea@$ASA x Y`@ 2 (.(25%few trees<25% so dominant alder thicket; sparse understory due to dense alderrelative cover of oak is about 43% which keys to CEGL002461; since close to 40% could also be CEGL00245770% oak but substantial amount of maple so second choice would be CEGL002457; sugar maple dominantdominated by leatherleaf with some alderdeciduous forest with canopy dominated by paper birch; because red maple is >25% it would not key to CEGL2468 but since lost to 25% cover put into CEGL002468 as secondary type; CEGL002467 fits better; red maple may be dominant; often well-developed shrub layer, so selected as primary typemore of a mix of hemlock, birch and maplered pine is dominant with black spruce and huckleberry and blueberry shrub pocketsdeciduous forest with strong oak component (>40% cover), therefore, primary is CEGL002461dominated by leatherleaf, Ledum and Myrica gale, but with alder and pine invading could become woodland or shrubland (CEGL005227)Alnus incana dominant with several cedar and red maple along margin (<5%)chose this AA because more sugar maple than red oak, no yellow birch in canopyfits this type but Populus absent and no other hardwoods are present besides AcerKeys out easily. Very little sugar maple, mostly red maple.area is mostly red pine with dense herb layer on top of moss and pine needles; if more white pine, then second choicepaper birch dominates the canopy with red maple subcanopyeroding sandn/clay cliffs with small rocks on beach; some vegetationAA point was where 3 polygons meet (to north of point is vegetation type CEGL002457); at first form for large polygon was completed (CEGL002457), then for small polygon south of point; form for CEGL002457 was discarded; Larix >25% cover but no Alnus seen, therefore doesn't fit CEGL002471; type CEGL005271 has black spruce (not seen); need new type?patchy alder distribution; enough for CEGL002381?@ qXad$%ASA x Y[@ F.F  2<i@APIS.AA625AshlandCEGL002444 - Pinus strobus / Vaccinium spp. ForestPinus resinosa / Vaccinium spp. ForestCEGL002443Pinus strobus / Vaccinium spp. ForestCEGL002444APISOuter Island15NAD838.8mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandwell-drainedplant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak73:45CEGL005228x~||pjha#ooooggaUUIICC+++++%_____VJE72Ea>$AjSA x Y]@2(.P<<P @APIS.AA624BayfieldBetula papyrifer/Diervilla lonicera - (Abies balsamea) ForestCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestBetula papyrifera / Diervilla lonicera - (Abies balsamea) ForestCEGL002463Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISMeyers Beach - Ridge Road15NAD838.1mC. Groebner, N. Murphy1FlatFlat (n/a)High levelflatUplandw@plant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mr@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak64:40maple, birch, aspenx{peZOOG9)=1````VJE72Eal<%ASA x YX@ F .F( Yi@APIS.AA623AshlandTsuga canadensis - (Betula alleghaniensis) ForestCEGL002598APISOuter Island15NAD836.8mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandF@!west of polygon is sphagnum bogplant stemsEvergreenNeedle-leavedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mvery little deciduous speciesmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:55CEGL005044 - hemlock, cedar, birchx^\\820){{sdYL  ______VJE12Őa$ASA x YY@ F.(Y i@ APIS.AA622AshlandEroding Clay Bank Sparse VegetationCEGL002584APISOuter Island15NAD836.8mC. Groebner, N. MurphySteep34 degreesNEToeslopebankUpland@plant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:30CEGL002479 - Populus, pine, birchvvvvvvvllaVVJJ?1!______VJE12EyaD $ATSA x Y W@ < .<2 Y`i@APIS.AA621BayfieldPopulus tremuloides - Betula papyrifera - (Abies balsamea, Picea glauca) ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APIS Sand Island62115NAD837.7mC. Groebner, N. Murphy, B. Dunlap1Gentle2 degreesVariableHigh slopeflatUplandSaturatedR@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 mKeys out easily, good fit./@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:51 PME - Acer; W - Alnusxb]QQ)))))) {phfCCCCC=622----````VJE16M- Cab+$ASA x Y[@ F.(PY `i@ APIS.AA629BayfieldAlnus incana Swamp ShrublandCEGL005228 - Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandAlnus incana Swamp ShrublandCEGL002381Chamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISLittle Sand Bay15NAD838.8mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLow levelflatPalustrine6@plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:05CEGL005228xd___SSSSSSI??4))|xxxxxx[UUI~````VJE72Eyaz$ASA x YX@ P .( Y @APIS.AA628AshlandCEGL002461? - Quercus rubra - Acer saccharum ForestAcer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457Quercus rubra - Acer saccharum ForestCEGL002461APISBasswood Island62815NAD8310mC. Groebner, N. Murphy, B. DunlapGentle1 degreeVariableHigh slopeflatUpland@plant stemsCold-deciduousBroad-leavedForest@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak610:26Cold-deciduous throughoutxb``E><5yqqNNNNNIB>>9999 _____VJE76Ea$A@SA x Y^@ F .P2Y<k@APIS.AA627AshlandCEGL005044 - Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Tsuga canadensis - Acer saccharum - Betula alleghaniensis ForestCEGL005044APISStockton Island01115NAD837.8mK. HiserGentle3 degreesNWMidslopeslopeUpland dry uplandplant stemsCold-deciduousBroad-leavedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F1061:30NW - CEGL005044 - Tsuga canadensis-Acer sac Forestx`[[[OOOOOOOEE:/$~~~~a[[O _____VJE76E0a $AnSA x Y@W@ P .< Y< @APIS.AA626BayfieldPopulus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestPopulus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APIS Sand Island62615NAD834.5mC. Groebner, N. Murphy, B. Dunlap1GentleVariableHigh slopeflatUplandd@plant stemsCold-deciduousBroad-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 mv@R@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak611:56 AMN - Alnus incanaxIGG5+)"zj]]QQQQIIC77--%#sg````VJE76EzLVALyCR}  & " u A `  @_%,C$Tdry upland; dense pockets of tall-shrub Abies; lots of dead and downeddry upland; dense pockets of tall-shrub Abies; lots of dead and downed trees; standing dead Picea glauca; no birch seen; linear slope (drain?)steep NW-facing slope (and flatter top?); dry; standing dead paper birch; dense and dark site (no herb layer); dense tall-shrub layer of Abies and Thujavery dense shrub layer; snags of pine; no herb layernarrow polygon on flat bluff near steep clay bank to west; blowdowns in and near polygon (freshly downed Abies and old blowdowns); standing dead paper birch; dense tall-shrub layer and sparse herb layerwell-drained; eroding clay bank; all herb species <5% but listed more common oneswell-drained; mostly leatherleaf with Vaccinium and bog laurel on sphagnum mat; margin has Myrica gale and alderpoorly drained; minor blowdown; pockets of standing water; black ash subcanopy and shrub layer; no spruce, some cedarstanding dead and downed paper birch; canopy openings with lots of dense Abies (5-10m tall); moist opening with Calamagrostis and Carex speciespoorly drained, standing water; dead standing snag; saturated soil; sphagnum mat below standing waterstanding dead trees and stumps; old beaver-chewed stumpswet, mesic forest; open grass (Calamagrostis) pocketssaturated soil; wet patches with many hummockswet, mesic forest; some wind damage; spruce tops broken off; understory mostly Calamagrostis with some Carex intumescenswell-drained; some blowdown (aspens); herb layer mostly sugar maple seedlings with <5% other species; rest litter/duff; canopy of aspen with sugar maple dominant in subcanopynarrow polygon parallels sand beach; unvegetated surface not taken at point but about 100m SE; standing dead birch trees; tall shrubs 5-10m tall; Abies and Picea glauca very dense; tree tops snapped offsmall wet shrubland next to beach of lak, sand spit blocking water flow out of shrublandwell-drained; herb layer is mostly sugar maple seedlings and litter/duffpoorly drained; pockets of standing water with Caltha palastris and sedges; drier areas have Clintonia and Maianthemumdry upland; basically flat with tree mounds throughout; lots of blowdown; oak and sugar maple seedlingssteep (deep) drainage to lake goes through polygonwell-drained; oak and maple seedlings; forest floor is 60% litter/duffwell-drained; alder around margin of bog and a few on mat; dense leatherleaf, no herbs except Carexdrainage makes up about 1/3 of polygon; in 1/2-ha area are beaver-chewed logs; some paper birch snags and rotting logs; NE/SW drainage along SW edge of polygon; drainage with sphagnum, Calamagrostis canadensis, Ilex verticillata and scattered red maple treesdry; major blowdown area (cedar) may impact AA; birch defoliated by caterpillars; Acer spicatum dominant shrubdry; cedar bark is stripped; defoliation by caterpillars; large trees, open understory; hemlock, sugar maple and cedar seedlingsminimal blowdown; well-drained; bracken fern dominant herbaceous species with Cladonia or Pleuoziumdry upland; many large hummocks; area is very uneven but generally sloping SW; trail goes through polygon; lots of sugar maple regeneration in herb layer; canopy about 20m tall; low diversity/cover in herb layerpoorly drained; all pines in bog equal about 5% cover; dominant shrub is leatherleaf with alder around margins and along boardwalk that runs through polygon from beach to beach; tree areas are above bog so have some Vaccinium angustifoliumpoorly drained; sparse understory due to dense alderevidence of blowdown; sparse understory, mostly leaf litter; herb layer dominant is sugar maple seedlings; all other herb species <5% ^ am$A@SA x Y_@ 2.233(( tnnb _____VJE72E xa$ASA x Y\@ F .F( Y( i@APIS.AA639AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestQuercus rubra - Acer saccharum ForestCEGL002461Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISStockton Island15NAD837mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUplandi@ plant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoFuji F10612:43xzxn0+++  ||vvccccc_XTTTTTT711%_____VJE72E0?aV#AbSA x Y@X@  <.F(Y2i@APIS.AA638BayfieldPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD835.6mC. Groebner, N. MurphyFlatFlat (n/a)High slopedrainage4@ plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mkeyed out easilymjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak62:30CEGL002381x!  xmmeWG::......$  ``````VJE12Aaj$ANSA x Y`@ <.Z(22Y<i@APIS.AA637AshlandCEGL002457 - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestQuercus rubra - Acer saccharum ForestCEGL002461Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APIS Oak Island15NAD832.1mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandH@ adjacent to oak-birch-mapleplant stemsCold-deciduousBroad-leavedForest20 - 35 m15 - 20 m 2 - 5 m 1 - 2 m <0.5 m@trail through polygonmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak68:00birch, maple, oakxvqqNBBBBBBB88-"  ~~xx`````ZSOOOOOO711%_____VJE72Őadg$A@SA x Y ^@ F.(Pdi@APIS.AA636AshlandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APIS Long Island15NAD837mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatPalustrineSaturatede@plant stemsEvergreenBroad-leavedDwarf shrubland 1 - 2 m <0.5 m <0.5 m <0.5 mP@1@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak71:15birch, oak, aspenx! yyyyyhZOBB666+  ______VJE12Ma3%ASA x Y Y@ 2 .<<Y< @APIS.AA635AshlandCEGL002071 - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestPopulus tremuloides - Betula papyrifera - (Acer rubrum, Populus grandidentata) ForestCEGL002467Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island63515NAD833mJ. Marr, B. DunlapGentle1 degreeVariableHigh levelflat@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mB@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First PhotoKodak72:55xojjj^^^^^^^TTI>3(( yssg_____VJE76A?*  Ba\$A&SA x Y`\@ 2(.<<50% in canopyover 60% clay/sand bank; rest is a mix of shrubs and herbs but none dominantmostly leatherleaf with Myrica gale; alder around margin with a few pine throughoutblack ash subcanopy; Larix is dominant in canopy so selected CEGL002471 as primary, but taking Fraxinus as dominant then second choice is CEGL002105keys better to CEGL002468 than CEGL002466, but fits description of CEGL002466 betterNothing dominant so best fit is wet meadow herbaceous mapclassCarex species not noted; Scirpus cyperinus dominant graminoidAlnus incana dominant shrub; <5% cover by conifers; mostly Fraxinus and Betula papyriferalooking W/SW to habitat; Fraxinus seems to be dominant in canopy with Betula and Abies balsamea in subcanopydifficult to dey; woodland physiognomy (standing dead birch so more forested in past); CEGL002466 often has Abies and Picea glauca in subcanopy (as here) and also lots in sapling layer; succeeding to CEGL002474?V i ?`a%A@SA x Y@]@ P.(YZP`i@ APIS.AA649Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISMichigan Island15NAD833.8mC. Groebner, N. Murphy1FlatFlat (n/a)Low levelflatPalustrineSaturatedh@plant stemsPerennial herbMixedHerbaceous vegetation10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m|@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:20birch, maplex&$$ kdTGG;;;0$$____VJE12Mya#A@SA x Y`c@ ( 2.(YZ`j@APIS.AA648BayfieldCarex (rostrata, utriculata) - Carex lacustris - (Carex vesicaria) Herbaceous VegetationCEGL002257APIS Sand Island02815NAD836.7mJ. Marr, M. SmithFlatFlat (n/a)Basin floordepressionPalustrine:@plant stemsPerennial herbGraminoidHerbaceous vegetation 2 - 5 m0.5 - 1 m <0.5 mz@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon711:05Forest edge - Acer, B. papyrifera, P. tremuloidesxDBByn^QQEEEE99-  ``````VJE16E0xa)$A@SA x YZ@ 2(. <YP`j@APIS.AA647BayfieldCEGL005078 - Salix interior - Salix eriocephala Sandbar ShrublandAlnus incana Swamp ShrublandCEGL002381Salix interior - Salix eriocephala Sandbar ShrublandCEGL005078APISLittle Sand Bay15NAD832.2mC. GroebnerFlatFlat (n/a)High levelPalustrine7@plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@road to the southmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:46CEGL005098 - Beach habitatxqjha#zzzznnnbbVVPPCCCCC=6222222`````VJE72Dab&%A@RSA x Y ]@  2.( Y(F @APIS.AA646AshlandPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISMichigan Island05015NAD835.9mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatPalustrineSaturated0@30% plant stems, 20% sphagnumEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m "woodland" (<60% canopy cover)mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1065:03xRPPPJH>ujKK???4(("  ______VJE16M?a~-$ASA x YZ@ (<.< YP`j@APIS.AA645BayfieldFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APISLittle Sand Bay15NAD834.3mC. GroebnerFlatFlat (n/a)High levelflatPalustrinez@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of First Photo3:26E - Tsuga canadensisynnfXH;;////##``````VJE12Eg 5a$AeSA x Y`@ 2.((Y `j@APIS.AA654AshlandAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474APIS Cat Island75315NAD832.5mJ. Marr, K. HiserFlatFlat (n/a)MidslopeflatUpland@k@&plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ (@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:34W-Steep clay bank w/ scattered S1 aspen, birchxSQQ }rrjcA4(______VJE160af'%ASA x YY@ F.(Y`j@ APIS.AA653AshlandEroding Clay Bank Sparse VegetationCEGL002584APISOuter Island15NAD835.7mC. Groebner, N. MurphySteep32 degreesEToeslopebankUplandS@plant stemsCold-deciduousBroad-leavedSparse vegetation 2 - 5 m 1 - 2 m <0.5 m@)@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photo12:45CEGL002468-Populus, aspen, birch, sugar maplex||pppppppff[PPPP=/______VJE12ExgaFj$ASA x Y ^@ F.(P d`j@APIS.AA652AshlandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APIS Long Island15NAD835.7mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatPalustriner@plant stemsEvergreenBroad-leavedDwarf shrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:40oak, birch, cedar, maplex*((||pp_QF99----!!______VJE12Ea$ASA x YZ@ <.<(YP  @APIS.AA651AshlandLarix laricina/Alnus incana ForestCEGL005271 - Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestLarix laricina / Alnus incana ForestCEGL002471Picea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISStockton Island15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrineSaturatedw@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m(@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak2:55same as 78 alnus incanaxuuj_TIIA:  rll`____VJE72Moa#ASA x Yc@oK.2Y(`j@APIS.AA650BayfieldCEGL002468 - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS mainland05915NAD838.1mJ. Marr, M. Smith2Gentle4 degreesNW320LowslopeflatUpland@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon7xvvvvvvlbbWLA66. ||p`````VJE76E0LVALGPS point is aboutGPS point is about 5m from top of bankfrom AA point looked north into polygon' xa$ApSA x Y@\@ 2 .( Y2`j@ APIS.AA659BayfieldAmmophila breviligulata - (Schizachyrium scoparium) Herbaceous VegetationCEGL005098APIS mainland15NAD833mJ. Marr, K. Hiser, U. Gafvert, A. KirschbaumGentle1 degreeNLow levelbeachUpland@plant stemsPerennial herbGraminoidHerbaceous vegetation 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus51:30N-Beach with Betula, Thuja, A. rubrumx'%%rgWJJ>>>>66/$$"``````VJE12E8`aX}$A@XSA x YW@ P .FY2 @APIS.AA658AshlandCEGL002479 - Pinus strobus - Populus tremuloides / Corylus cornuta ForestPinus strobus - Tsuga canadensis Great Lakes ForestCEGL002590Pinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APISBasswood Island65815NAD839.6mC. Groebner, N. Murphy, B. DunlapModerate11 degreesWLowslopedrawUpland@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mkeys to mixed forestmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak711:11Pinus resinosa close to shorexhcccAAAAAAA77,!  nnnnnha]]XXXX;55)_____VJE76Ea(#A@SA x Y]@ 2.2< Y2 `j@APIS.AA657BayfieldPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APIS mainland07015NAD836.8mJ. Marr, K. HiserSomewhat steep16 degreesWHigh slopeslopeUpland@plant stemsCold-deciduousBroad-leavedWoodland15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@ Hieracium sp. likely exoticmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:48xHFFF@>4||rdTGG;;;;33,  ``````VJE16E0?aZ$ASA x Y`@ <.2<( Y @APIS.AA656AshlandCEGL002479? - Pinus strobus - Populus tremuloides / Corylus cornuta ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Pinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479APISOtter Island77015NAD834.9mJ. Marr, K. HiserSomewhat steep20 degreesWMidslopeslopeUpland@plant stemsMixed evergreen - cold-deciduousMixedForest20 - 35 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 mp@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F10610:39E-Thuja-Betula dominatedxRMMMAAAAAA777,!  wwwwwqjffaaaaGAA5_____VJE76E0a$A@SA x YZ@ F. ZY`j@ APIS.AA655AshlandPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125APISStockton Island02615NAD832.8mJ. MarrGentle4 degreesWInterfluve/SummitridgeUpland6@plant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m @ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoOlympus83:00W-large open sedge-cladium wetlandx><<rgZZNNNNFF?,,*______VJE16E0LVALD *  6  T |2#W +4well-drained; young paper birch stand with red maple inwell-drained; young paper birch stand with red maple in subcanopy; many cedar saplings and some seedlings (<5%)dry upland; rolling old dune; Quercus leaves deeply cleft (Q. ellipsoidalis or Q. rubra?)well-drained; most herbaceous species <5%; Ranunculus acris present <5%slope/old dune; about 20m from point is a small Myrica swalepoorly drained soil?; moist depressions; lots of downed trees; conifer forest with very dense tall shrubs and trees (5-10m tall), especially Abiespast logging (sawn off stump, canopy gaps with Acer spicatum, upland site); deciduous trees with patches of dense canopy cedarsall herb species are <5%; mostly leaf litter; NE edge of polygon has dense stand of balsam firpoorly drained; mostly sphagnum mat; sparse understory due to dense alderpoorly drained; wet area, beaver evidence; dead snagswell-drained; Poa species <5%; Arctostaphylos along margin on beach sidecliff edge close; lakeshore about 5m to west; site right on ridge; water and rock below; equal amounts of birch and balsam fir and sugar maple in subcanopy; <5% sugar maple in canopy; some fir seedlingsdry upland, slight slope; lots of rotting moss-covered logs; standing dead paper birch and downed birch branches; recently downed Abies has created canopy gap; canopy is about 20m tall; lots of cedar and fir regeneration in herb layer, otherwise low cover in herb layerhummock/hollow microtopography; dense sphagnum cover; seasonally floodedvegetation on clay bank varies from sparse cover of grasses and herbs to dense cover of tall shrubs and trees (5-10m tall); clay soil; other species (herbs, etc.) present but not easily identified from rocking boatpoorly to moderately drained; blowdown - broken off tops of spruceyoung trees; well-drained; all canopy species equal 5%; beaver pond has some sedges and grasses but herb layer has forbsmany standing snags of paper birchwell-drained; area is mostly Rubus and Vaccinium with some trees and shrubs; along shoreline pockets of Elymus and Calamagrostis - both <5%; it's possible the oak is Quercus ellipsoidalis but can hybridize with Quercus rubrapoorly drained; some standing water; herb layer sparse due to dense Rubus dominance; polygon borders beaver-influenced areaevidence of blowdown; some standing water in hemlock stands; sparse understory - all herbs <5%long, about 60m wide wetland behind (north of) narrow strip of mostly white pine and beachgrass; sphagnum moist; wetter pockets with Cladium, Carex utriculata and Menyanthes; scattered black spruce and tamarack; leatherleaf about 30 cm tallmesic habitat; old downed trees; herb layer about 50% litter/duffstream running through plot west to lake; ravine with flowing stream; sparse understory except along stream (ferns); all herbs listed are <5% except bracken fernminor blowdown; dead Abies and Picea snags; could impact communityvery poorly drained; standing water for 1/3 of area; Pogonia ophioglossoides and Calopogon tuberosus in flower <5%; <5% standing water on sphagnum matpolygon arm east of point has sand beach grading into boulder shoreline; dunegrass community disappears in forested community of paper birch, Thuja, etc.lakeshore 15m to west; some evidence of blowdown; aspen <5% cover and cedar <5%; large stand of red oak to the east; large white pines and some red pines; area is along ridge above waterZ pa $A@SA x Y`^@ < .F< Y2 @APIS.AA663BayfieldCEGL002071? - Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468Acer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISSand River wetland area15NAD83C. GroebnerFlatFlat (n/a)High levelflatUplandC@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m(@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:04Black ash forestxfaaaUUUUUUUKK@5* wqqe `````VJE72Ea$ASA x YW@ P.2(Y `j@APIS.AA662AshlandPopulus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISBasswood Island66215NAD837.9mC. Groebner, N. Murphy, B. Dunlap1Gentle2 degreesWHigh sloperavineUpland@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m!Populus is 99% P. grandidentatamjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:11Populus and Betula throughoutx`^^?970tdWWKKKKCC;//-"______VJE16Eaj$ASA x YY@ ( (.( Y @APIS.AA661AshlandCEGL002457? - Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestBetula alleghaniensis - (Acer saccharum, Picea glauca) Forest [Provisional]CEGL005245Acer saccharum - Betula alleghaniensis - (Tilia americana) ForestCEGL002457APISRocky Island15NAD832.7mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatPalustrineD@plant stemsCold-deciduousBroad-leavedForest@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak61:00CEGL002457-sugar maple, yellow birchnhf_!|xxxxxx^XXL _____VJE72Ea$AuSA x YZ@ Z.( Pd`i@ APIS.AA660AshlandChamaedaphne calyculata-Myrica gale/Carex lasiocarpa Dwarf-shrublandChamaedaphne calyculata - Myrica gale / Carex lasiocarpa Dwarf-shrublandCEGL005228APISStockton Island15NAD839.4mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aLowslopeflatPalustrineSaturated@80% plant stems, 10% sphagnumEvergreenBroad-leavedDwarf shrubland <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak69:25white pine/coniferxiggSMKDuuoe`TOIG/////)"____VJE12M@LVALpZ 2overall vegetation between 10 and 20% cover so doesn't key to 29Bmore balsam fir than hardwoods (birch and maple)it looks like Larix is plentiful so had to go with CEGL002471 even though alder is dense with no shrub layermix of sedges and grasses with large component of red maple shrubs; no other community fitPinus strobus dominant with Juniperus communis understory shrubmore paper birch than aspen; second choice is with more balsam fir but no red maple; reason for primary choice of CEGL002466 but CEGL002474 has white pinemixed tree type (>25% cover deciduous trees in canopy); keys to CEGL002479; however descriptions for two conifer types (CEGL002445 and CEGL002449) fit more or less; which one is it?viewed from boat (where GPS reading taken) about 15m west and 56m north of AA point on shore; type is CEGL002584 but data collection was scanty; overall vegetation cover >10%a few Pinus strobus on the northern boundary of polygon; dominant spruce/cedar and paper birch; looking southeast to do assessment, mostly sphagnum and Gaultheria hispidula and pockets of Calamagrostispolygon winds around two dense hemlock stands; small red maple dominant (2-5" dbh); beaver pond present with snags and downed logs; canopy has a few emergent trees <5%for lack of a better AA, this polygon is a mix of begetation on dunes along shoreline with jack pine and raspberry dominantdoesn't key out; goes to 1A, 2B, 29A but not beyond; unusual communitymostly red maple (reason for first choice); borders beaver-influenced area; confusing to determine what's in AA; thin narrow band going mostly east around beaver pond to the south has hardwood forest with oak to the north; assessed low-height mix of deciduous/coniferdominated by sphagnum and ericaceous shrubs; how close to the shore does a community need to be in order to be a shore fen? not on shore, so placed in CEGL005228 as secondary; also no Myrica gale seen ] #aa$ASA x Y ^@ F. ( @APIS.AA668AshlandCEGL002441 - Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestPinus banksiana - (Pinus resinosa) - Pinus strobus / Juniperus horizontalis Wooded Herbaceous VegetationCEGL005125Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002441APIS Long Island15NAD832.8mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUpland@ plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak611:30Jack pine, beachxvqqqeeeeeee[QF;/$$ tnnb"_____VJE72EaR %ASA x Y@]@ P .((Y`j@APIS.AA667AshlandAPISMichigan Island06015NAD832.4mJ. Marr, K. HiserModerate12 degreesNHigh slopedune (undifferentiated)Upland dry, sandyplant stemsCold-deciduousBroad-leavedShrubland 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1054:12S-lagoon and sedge fenx{vvvjjjjjjj``UJJ>>3%e___________VJE06E8ya1%ANSA x Y Y@  P.<( 11%%%%   ````VJE16E?aV0%A_SA x Y[@  P. F2(d`i@APIS.AA671AshlandPicea mariana-(Larix lricina)/Ledum groenlandicum/Sphagnum spp. ForestPicea mariana - (Larix laricina) / Ledum groenlandicum / Sphagnum spp. ForestCEGL005271APISOuter Island15NAD837.1mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrineD@ plant stemsMixed evergreen - cold-deciduousMixedForest10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:15birch, aspenxztrk-((({{uidXSMK33333-&""""""____VJE12Ea^C%ADSA x YX@ ( (.PY2`j@APIS.AA670AshlandAcer rubrum - Fraxinus spp. - Betula papyrifera / Cornus canadensis ForestCEGL002071APISOuter Island15NAD839.8mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandz@ plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mN@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:30CEGL002457-hemlock, maple, birchx$""vkkcUE88,,,,$$______VJE12Ea#AlSA x YX@ (.<<(2Y< @APIS.AA669BayfieldCEGL002466 - Populus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD839.5mC. Groebner, N. MurphyGentle5 degreesNToeslopeflatUpland$@ plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 mmore balsam firmjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak610:45CEGL002463-balsam fir, paper birch, aspenx}xxx[[[[[[[QQF;0%%keeY`````VJE72E L  ap$ASA x YZ@ P.(FY`i@ APIS.AA678AshlandLarix laricina/Alnusincana ForestLarix laricina / Alnus incana ForestCEGL002471APISStockton Island15NAD832.0mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh slopeflatPalustrineK@plant stemsEvergreenNeedle-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:25tamarack, balsam firx$"" wwo`UHH<<<<00* ____VJE12EaP5%A@LSA x Y Y@ <. YF `j@APIS.AA677Ashlandwet meadow mixed herbaceous mapclassMixed Herbaceous Wet Meadow (map class)HWMAPISOuter Island15NAD8310mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatPalustrineSaturated7@plant stemsCold-deciduousBroad-leavedShrubland10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak64:10CEGL002457 - Maple, birchx422xxm_OBB666+  ____VJE12Mah#%AmSA x Y[@ <.<(<2 @APIS.AA676AshlandPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APISOuter Island15NAD832.4mC. Groebner, N. MurphyGentle4 degreesWHigh slopeflatUplandJ@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m~@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:40CEGL005228x vkkc\:--!!!!______VJE12Eax$ASA x YW@ < .<Y( @APIS.AA675AshlandCEGL002466 - Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISBasswood Island67515NAD837.9mC. Groebner, N. Murphy, B. DunlapGentle1 degreeVariableHigh slopeflatUpland@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m4@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak2:41SE-Q. rubra; E-A. saccharumx~yyymmmmmmmccXMB77/!lffZ _____VJE76Eoat$ASA x Y`@ 2.2<2Y`j@APIS.AA674AshlandCEGL002445 - Pinus strobus / Acer spicatum - Corylus cornuta ForestPinus strobus - Populus tremuloides / Corylus cornuta ForestCEGL002479Pinus strobus / Acer spicatum - Corylus cornuta ForestCEGL002445APISOtter Island77715NAD836.9mJ. Marr, K. HiserGentle1 degreeNWMidslopeflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 mj@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1063:58xD???333333) {{hhhhhb[WWRRRR822&_____VJE76E0? ^ a g$A*SA x Y ^@ <.<< @APIS.AA683AshlandCEGL002441 - Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestPinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589Pinus banksiana / Vaccinium spp. / Pleurozium schreberi ForestCEGL002441APIS Long Island08715NAD833.5mJ. Marr, K. HiserGentle3 degreesNMidslopeslopeUpland>@plant stemsEvergreenNeedle-leavedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m <0.5 mD@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1061:41xQLLL@@@@@@6," wwwwwqjffaaaaHBB6_____VJE76E8?a#ASA x Yc@ #<.<(<Y <`j@APIS.AA682BayfieldCEGL002449 - Thuja occidentalis / Abies balsamea - Acer spicatum ForestThuja occidentalis - (Picea mariana, Abies balsamea) / Alnus incana ForestCEGL002456Thuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449APIS Sand Island04515NAD838.5mJ. Marr, M. SmithVariableLowslopeflatPalustrine@30% plant stems, 30% bryophytesEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoCanon72:19xWRRRFFFFFF<22'~~~~~xqmmhhhhOII=`````VJE76E0?a0$ASA x Y]@ F .<(Y2 `j@APIS.AA681BayfieldCEGL002468? - Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestThuja occidentalis / Abies balsamea - Acer spicatum ForestCEGL002449Populus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APIS mainland07615NAD833.6mJ. MarrGentle2 degreesEMidslopeflatUpland@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:20xkfffZZZZZZPFF;0% nhh\ `````VJE76E0?a$ASA x Y`@  P.( Y `j@ APIS.AA680AshlandEroding Clay Bank Sparse VegetationCEGL002584APIS Cat Island76015NAD835.1mJ. Marr, K. HiserVery steep50 degreesWMidslopebankUplandhighly eroded, steep bankplant stemsPerennial herbBroad leaf herbaceousHerbaceous vegetation 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1056:59x {{dM=00    ______VJE16Ey?a#A SA x Y@X@ P  .<< Y `j@APIS.AA679BayfieldCEGL002466 - Populus tremuloides - Betula papyrifera (Abies balsamea, Picea glauca) ForestAbies balsamea - Betula papyrifera / Diervilla lonicera ForestCEGL002474Populus tremuloides - Betula papyrifera / (Abies balsamea, Picea glauca) ForestCEGL002466APISMeyers Beach15NAD836.9mC. Groebner, N. MurphyGentle1 degreeNWHigh levelflatUpland`@plant stemsMixed evergreen - cold-deciduousMixedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m`@ mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:35CEGL002466xojjj^^^^^^^TTI>3(( keeY`````VJE72ELVALl F T keyed out easily; dominated by paper birch and red maple with cedar seedlings and saplings in the understorymixed evergreen/deciduous type; Quercus (ellipsoidalis, rubra, hybrid?) >25% cover, as is jack pine; keys to CEGL002478mix of Pinus strobus and Pinus resinosa; not along beach; birch and maple <5%Fraxinus only canopy species; balsam fir and paper birch in subcanopy, ash seedlings; dense understory of Rubus pubescensjack pine woodland with lots of juniper and Arctostaphylos; keys to CEGL005125 (<60% tree canopy cover); does have Quercus however; CEGL002589 is secondary choicekeys to CEGL002456 (either via 1B or in wetland section via 39B); deciduous trees <25% cover; possibly CEGL002449difficult to determine with deciduous or mixed deciduous/coniferous; seems to be enough cedar for mixed (CEGL002450); if cedar cover overestimated, the would key to deciduous CEGL002468 (or CEGL002457?)  aF;%ASA x YX@ (.F<2Y2j@APIS.AA687AshlandPopulus tremuloides - Betula papyrifera / Acer saccharum - Mixed Hardwoods ForestCEGL002468APISOuter Island15NAD837.7mC. Groebner, N. MurphyFlatFlat (n/a)High slopeflatUplandq@plant stemsEvergreenNeedle-leavedForest10 - 15 m 5 - 10 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak62:35CEGL005044 - paper birch, hemlockx200 ynnfWL??3333++%  ______VJE12Eaq$A@SA x Y ^@ < .2FYj@APIS.AA686AshlandPinus banksiana - (Pinus resinosa) - Quercus ellipsoidalis / Carex pensylvanica ForestCEGL002478APIS Long Island09315NAD833.2mJ. Marr, K. HiserModerate8 degreesSWHigh slopedune (undifferentiated)Upland[@plant stemsMixed evergreen - cold-deciduousMixedWoodland10 - 15 m 5 - 10 m 2 - 5 m0.5 - 1 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoFuji F1064:27xA???97-j]]QQQQII0$$   ______VJE16E0?a#%ASA x Y[@ F.< (2F @APIS.AA685AshlandCEGL002589 - Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestPinus strobus / Vaccinium spp. ForestCEGL002444Pinus banksiana - Pinus resinosa - Pinus strobus Dune ForestCEGL002589APISOuter Island15NAD834.8mC. Groebner, N. MurphyFlatFlat (n/a)High levelflatUplandwell-drainedplant stemsEvergreenNeedle-leavedForest15 - 20 m10 - 15 m 2 - 5 m <0.5 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak63:25CEGL005288x|zs5000$$$$$$vvppXXXXXRKGGGGGG-''_____VJE72Ea/$A SA x Y[@ P.< (YP`i@APIS.AA684BayfieldFranxinus nigra-Mixed Hardwoods-Conifers/Cornus sericea/Carex spp. ForestFraxinus nigra - Mixed Hardwoods - Conifers / Cornus sericea / Carex spp. ForestCEGL002105APISLittle Sand Bay15NAD832.7mC. Groebner, N. Murphy1Flatn/aFlat (n/a)n/aHigh levelflatPalustrineI@plant stemsCold-deciduousBroad-leavedForest15 - 20 m10 - 15 m 2 - 5 m 1 - 2 m <0.5 m <0.5 m@mjrOpt1=Camera, Opt2=Number of Images, Opt3=Time of first photoKodak612:15maple, birch, ashxohf_!snb]WU=====70,,,,,,    ````VJE12EV+NA 2 v  j  _  E 8ypbS<-u  Ah@APIS.AA435grassH>5-15%mjr7222&$$$$$ 6@Y@APIS.AA141bryophytesCertainSSN>1-5%bdFBBB862))) K7 Ah@APIS.AA435bryophytesN>15-25%mjr>999+))))) 6 Ai@APIS.AA500bryophytesN>5-15%mjr<777+))))) 6@h@APIS.AA432MniaceaeN>1-5%mjr8333)''''' 6 Ah@APIS.AA431bryophytesN>5-15%mjr<777+))))) 6Ah@APIS.AA460bryophytesN>15-25%mjr>999+))))) 6 Al@APIS.AA123bryophytesN>25-35%JFD>999+))))) 6 Al@APIS.AA193bryophytesN>15-25%JFD>999+))))) 6Al@APIS.AA199bryophytesN>15-25%JFD>999+))))) 6@l@APIS.AA206bryophytesN>1-5%JFD:555+))))) 6  Al@APIS.AA216bryophytesN>5-15%JFD<777+))))) 6  Al@APIS.AA120bryophytesN>5-15%JFD<777+))))) 6 Al@APIS.AA217bryophytesN>5-15%JFD<777+))))) 6Al@APIS.AA155PoaceaeH>15-25%JFD;666(&&&&& 6@l@APIS.AA119bryophytesN>1-5%JFD:555+))))) 6@l@APIS.AA203PoaceaeH>1-5%JFD7222(&&&&& 6 @l@APIS.AA204unknownA1>1-5%JFD9444*&&&&& 6 Al@APIS.AA205bryophytesN>5-15%JFD<777+))))) 6@l@APIS.AA249bryophytesN>1-5%JFD:555+))))) 6  Al@APIS.AA155mosses (non-sphagnum)N>5-15%JFDGBBB644444 6 @l@APIS.AA200bryophytesN>1-5%JFD:555+))))) 6@l@APIS.AA212bryophytesN>1-5%JFD:555+))))) 6 Al@APIS.AA231bryophytesN>5-15%JFD<777+))))) 6Al@APIS.AA172mosses (non-sphagnum)N>25-35%JFDIDDD644444 6@l@APIS.AA176bryophytesN>1-5%JFD:555+))))) 6 @l@APIS.AA142bryophytesN>1-5%JFD:555+))))) 6@l@APIS.AA149bryophytesN>1-5%JFD:555+))))) 6 Al@APIS.AA180bryophytesN>5-15%JFD<777+))))) 6 Bl@APIS.AA240bryophytesN>95%JFD8333+))))) 6 Al@APIS.AA240PoaceaeH>15-25%JFD;666(&&&&& 6@l@APIS.AA167bryophytesN>1-5%JFD:555+))))) 6 @l@APIS.AA182bryophytesN>1-5%JFD:555+))))) 6 @l@APIS.AA206PoaceaeCertainH>1-5%JFD@;;;1//&&& K6Al@APIS.AA169bryophytesN>15-25%JFD>999+))))) 6 Al@APIS.AA224bryophytesN>5-15%JFD<777+))))) 6@l@APIS.AA183bryophytesN>1-5%JFD:555+))))) 6  Al@APIS.AA184bryophytesN>5-15%JFD<777+))))) 6  Al@APIS.AA129bryophytesN>5-15%JFD<777+))))) 6 Al@APIS.AA173bryophytesN>5-15%JFD<777+))))) 6 Bl@APIS.AA185fernH>35-45%JFD8333%##### 6@l@APIS.AA246bryophytesN>1-5%JFD:555+))))) 6@l@APIS.AA225bryophytesN>1-5%JFD:555+))))) 6  @@JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCJJ^bokYbMJbJksJ`fkWioL^JbO3J``dfWY^JLiQqY^YUo^JmJkMWYxJMWviYo`kMdfJiYo`WQiLJMQdokqQUQmJmYdbgMJiQuidkmiJmJomiYMo^JmJMJiQu^JMokmiYkMJiQuqQkYMJiYJWQiLJMQdokqQUQmJmYdb{sMWJ`JQOJfWbQMJ^vMo^JmJMJiQud^YUdkfQi`JkfWJUbo`kfffddiSQbOsJiSkWioL^JbO/;SiJuYbokbYUiJ`YuQOWJiOsddOkMdbYSQikMdibokkQiYMQJMJiQukffSdiQkmCfYMQJ`JiYJbJ^JiYu^JiYMYbJ^QOo`UidQb^JbOYMo`kfWJUbo`kffSdiQkm?fYbokLJb\kYJbJfYbokiQkYbdkJhoQiMokQ^^YfkdYOJ^YkMJiQufQbkv^qJbYMJSdiQkmGfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmDmkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKlmkoUJMJbJOQbkYkJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7s4JMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sWJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sbJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7siJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7soJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7syJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC(JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC0JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC6JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC7JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC?JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCBJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCCJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCJ B @ @     @JLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmC)JLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCSJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmC^JLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmC`JLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmClJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCuJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmC}JLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJLYQkLJ^kJ`QJLQmo^JfJfviYSQiJOYQiqY^^J^dbYMQiJSdiQkmCJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7s4JMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sWJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sbJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7siJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7soJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7syJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQiioLio`SiJuYbokkffLQmo^JfJfviYSQiJMdibokMJbJOQbkYkSdiQkm7sJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC(JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC0JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC6JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC7JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC?JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCBJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCCJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCJ @ @ @ @ @ @ @JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCRMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCVMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC]MQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC_MQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCdMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCkMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCkMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCwMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmC{MQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkmY^YJJ`QiYMJbJSdiQkmCMQikJMMWJio`mY^YJJ`QiYMJbJdkmivJqYiUYbYJbJ^dbYMQiJMJbJOQbkYkSdiQkmCMQikJMMWJio`mY^YJJ`QiYMJbJdkmivJqYiUYbYJbJ^dbYMQiJMJbJOQbkYkSdiQkmC^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k3^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k5^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k=^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;kM^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k[^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;km^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;ku^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJkJ^YukffLQmo^Jfo`Y^JMWJ`JQOJfWbQMJ^vMo^JmJkWioL^JbO;k^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO^bokYbMJbJksJ`fkWioL^JbO!^bokYbMJbJksJ`fkWioL^JbO$^bokYbMJbJksJ`fkWioL^JbO'^bokYbMJbJksJ`fkWioL^JbO(^bokYbMJbJksJ`fkWioL^JbO)^bokYbMJbJksJ`fkWioL^JbO1^bokYbMJbJksJ`fkWioL^JbO2^bokYbMJbJksJ`fkWioL^JbO3?@@@  @ @ @@  @fYbokLJb\kYJbJfYbokiQkYbdkJhoQiMokQ^^YfkdYOJ^YkMJiQufQbkv^qJbYMJSdiQkmGYbokLJb\kYJbJfYbokiQkYbdkJhoQiMokQ^^YfkdYOJ^YkMJiQufQbkv^qJbYMJSdiQkmGYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGNYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGPYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmG^YbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGgYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGYbokLJb\kYJbJfYbokiQkYbdkJfYbokkmidLokOobQSdiQkmGYbokLJb\kYJbJqJMMYbYo`kfff^QoidxYo`kMWiQLQiYSdiQkmCYbokiQkYbdkJfdfo^okmiQ`o^dYOQkOYQiqY^^J^dbYMQiJqJMMYbYo`kffSdiQkmCSYbokiQkYbdkJfdfo^okmiQ`o^dYOQkOYQiqY^^J^dbYMQiJqJMMYbYo`kffSdiQkmCYbokiQkYbdkJfdfo^okmiQ`o^dYOQkOYQiqY^^J^dbYMQiJqJMMYbYo`kffSdiQkmCYbokiQkYbdkJqJMMYbYo`kffSdiQkm"YbokiQkYbdkJqJMMYbYo`kffSdiQkm3YbokiQkYbdkJqJMMYbYo`kffSdiQkmgYbokiQkYbdkJqJMMYbYo`kffSdiQkm|YbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokiQkYbdkJqJMMYbYo`kffSdiQkmYbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm? YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?'YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?;YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YYbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?kYbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YbokkmidLokfdfo^okmiQ`o^dYOQkMdiv^okMdibomJSdiQkm?YbokkmidLokmkoUJMJbJOQbkYkUiQJm^J\QkSdiQkm?YbokkmidLokmkoUJMJbJOQbkYkUiQJm^J\QkSdiQkm?YbokkmidLokmkoUJMJbJOQbkYkUiQJm^J\QkSdiQkm?YbokkmidLokmkoUJMJbJOQbkYkUiQJm^J\QkSdiQkm?YbokkmidLokmkoUJMJbJOQbkYkUiQJm^J\QkSdiQkm?YbokkmidLokJMQikfYMJmo`Mdiv^okMdibomJSdiQkm4YbokkmidLokJMQikfYMJmo`Mdiv^okMdibomJSdiQkm7YbokkmidLokJMQikfYMJmo`Mdiv^okMdibomJSdiQkmwYbokkmidLokqJMMYbYo`kffSdiQkm>YbokkmidLokqJMMYbYo`kffSdiQkm>YbokkmidLokqJMMYbYo`kffSdiQkmSYbokkmidLokqJMMYbYo`kffSdiQkmYbokkmidLokqJMMYbYo`kffSdiQkmYbokkmidLokqJMMYbYo`kffSdiQkmdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmW2(  @ @ @fdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWJMQiioLio`fdfo^okUiJbOYOQbmJmJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW$JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW)JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW2JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW6JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW8JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW:JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWMJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWfJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWfJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWgJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWlJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWqJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWuJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWwJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmW|JLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJLYQkLJ^kJ`QJfYMQJU^JoMJSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmW)JMQikJMMWJio``YuQOWJiOsddOkSdiQkmW4JMQikJMMWJio``YuQOWJiOsddOkSdiQkmWLJMQikJMMWJio``YuQOWJiOsddOkSdiQkmW_JMQikJMMWJio``YuQOWJiOsddOkSdiQkmWiJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWnJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWnJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWqJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWsJMQikJMMWJio``YuQOWJiOsddOkSdiQkmW{JMQikJMMWJio``YuQOWJiOsddOkSdiQkmW|JMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWC @ @ @ @     fdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdfo^okmiQ`o^dYOQkLQmo^JfJfviYSQiJJMQikJMMWJio``YuQOWJiOsddOkSdiQkmWfdmJ`dUQmdbkffMQiJmdfWv^^o`kff`YOsQkmWQiLJMQdokqQUQmJmYdbKhoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?3hoQiMokioLiJJMQikJMMWJio`SdiQkm?5hoQiMokioLiJJMQikJMMWJio`SdiQkm?7hoQiMokioLiJJMQikJMMWJio`SdiQkm?7hoQiMokioLiJJMQikJMMWJio`SdiQkm?;hoQiMokioLiJJMQikJMMWJio`SdiQkm?LhoQiMokioLiJJMQikJMMWJio`SdiQkm?RhoQiMokioLiJJMQikJMMWJio`SdiQkm?ohoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?hoQiMokioLiJJMQikJMMWJio`SdiQkm?kJbOkmdbQLQOidM\UiQJm^J\QkkWdiQkfJikQqQUQmJmYdb]kJbOkmdbQLQOidM\UiQJm^J\QkkWdiQkfJikQqQUQmJmYdbokJbOkmdbQLQOidM\UiQJm^J\QkkWdiQkfJikQqQUQmJmYdbykJbOkmdbQLQOidM\UiQJm^J\QkkWdiQkfJikQqQUQmJmYdbkJbOkmdbQLQOidM\UiQJm^J\QkkWdiQkfJikQqQUQmJmYdbkJbOkmdbQUiQJm^J\QkkWdiQM^YSSkfJikQqQUQmJmYdbBkJbOkmdbQUiQJm^J\QkkWdiQM^YSSkfJikQqQUQmJmYdbkJbOkmdbQUiQJm^J\QkkWdiQM^YSSkfJikQqQUQmJmYdbmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmS!mWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSqmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkfYMQJ`JiYJbJJLYQkLJ^kJ`QJJ^bokYbMJbJSdiQkmSmWo[JdMMYOQbmJ^YkSiJuYbokbYUiJSdiQkmSBmWo[JdMMYOQbmJ^YkSiJuYbokbYUiJSdiQkmSimWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkm$mWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkm=mWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkm=mWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmDmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmDkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmD&@ @ @ @ @ @@@@@mWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmFWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmKWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmPWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmPWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmQWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmTWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmVWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmVWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmYWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkm`Wo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmdWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmnWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmuWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmwWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmxWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmWo[JdMMYOQbmJ^YkJLYQkLJ^kJ`QJJMQikfYMJmo`SdiQkmkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmK koUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmK3koUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKCkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKKkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKNkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmK^koUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKkkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKl1@ @@ @ @ @ @ @ mkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkSdiQkmKsLQmo^JJ^^QUWJbYQbkYkSdiQkmKtLQmo^JJ^^QUWJbYQbkYkSdiQkmKwLQmo^JJ^^QUWJbYQbkYkSdiQkmKxLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKLQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK!JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK"JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK$JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK(JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK0JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK1JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK8JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK?JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKAJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKAJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKDJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKLJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKMJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKPJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKSJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKVJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKWJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmK`JMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKcJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKcJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKcJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKdJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKmJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKtJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJMQikJMMWJio`LQmo^JJ^^QUWJbYQbkYkSdiQkmKJ^^QUWJbYQbkYkSdiQkmKN @mkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkkJmoiJmQOSdiQkmKmkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkkJmoiJmQOSdiQkmK}mkoUJMJbJOQbkYkLQmo^JJ^^QUWJbYQbkYkkJmoiJmQOSdiQkmK JfYk   !!!!!""""$$$$''''((((())))0000111122223333344445555566666777778888::::;;;;=====>>>>>????AAAABBBBBCCCCCDDDDFFFFFGGGGGJJJJKKKKLLLLMMMMMNNNNNPPPPQQQQRRRRSSSSTTTTVVVVVWWWWYYYY[[[[]]]]]^^^^____`````bbbbcccccddddffffggggiiiikkkkllllmmmmmnnnnnoooooqqqqqssssstttttuuuuuwwwwwxxxxxyyyyy{{{{{|||||}}}}}>JfYk>JfYk?JfYk?JfYk?JfYk?JfYkAJfYkAJfYkAJfYkAJfYkBJfYkBJfYkBJfYkBJfYkBJfYkCJfYkCJfYkCJfYkCJfYkCJfYkDJfYkDJfYkDJfYkDJfYkFJfYkFJfYkFJfYkFJfYkFJfYkGJfYkGJfYkGJfYkGJfYkGJfYkJJfYkJJfYkJJfYkJJfYkKJfYkKJfYkKJfYkKJfYkLJfYkLJfYkLJfYkLJfYkMJfYkMJfYkMJfYkMJfYkMJfYkNJfYkNJfYkNJfYkNJfYkNJfYkPJfYkPJfYkPJfYkPJfYkQJfYkQJfYkQJfYkQJfYkRJfYkRJfYkRJfYkRJfYkSJfYkSJfYkSJfYkSJfYkTJfYkTJfYkTJfYkTJfYkVJfYkVJfYkVJfYkVJfYkVJfYkWJfYkWJfYkWJfYkWJfYkYJfYkYJfYkYJfYkYJfYk[JfYk[JfYk[JfYk[JfYk]JfYk]JfYk]JfYk]JfYk]JfYk^JfYk^JfYk^JfYk^JfYk_JfYk_JfYk_JfYk_JfYk`JfYk`JfYk`JfYk`JfYk`JfYkbJfYkbJfYkbJfYkbJfYkcJfYkcJfYkcJfYkcJfYkcJfYkdJfYkdJfYkdJfYkdJfYkfJfYkfJfYkfJfYkfJfYkgJfYkgJfYkgJfYkgJfYkiJfYkiJfYkiJfYkiJfYkkJfYkkJfYkkJfYkkJfYklJfYklJfYklJfYklJfYkmJfYkmJfYkmJfYkmJfYkmJfYknJfYknJfYknJfYknJfYknJfYkoJfYkoJfYkoJfYkoJfYkoJfYkqJfYkqJfYkqJfYkqJfYkqJfYksJfYksJfYksJfYksJfYksJfYktJfYktJfYktJfYktJfYktJfYkuJfYkuJfYkuJfYkuJfYkuJfYkwJfYkwJfYkwJfYkwJfYkwJfYkxJfYkxJfYkxJfYkxJfYkxJfYkyJfYkyJfYkyJfYkyJfYkyJfYk{JfYk{JfYk{JfYk{JfYk{JfYk|JfYk|JfYk|JfYk|K[tomation#`utility>FiEiy V*\CG:\npsveg\archivedparks\apis\Program Files\Microsoft Office\1033\7.mda,..c 8PDAO>DAO 5E015ERK3Common6Shared\\dao360.dll#> 3.6 Object Li`brary$—rary$Library%am  *\G{000204EF-0000-0000-C000-000000000046}#4.0#9#C:\PROGRA~1\COMMON~1\MICROS~1\VBA\VBA6\VBE6.DLL#Visual Basic For Applications*\G{4AFFC9A0-5F99-101B-AF4E-00AA003F0F07}#9.0#0#C:\Program Files\Microsoft Office\Office12\MSACC.OLB#Microsoft Access 12.0 Object Library*\G{00020430-0000-0000-C000-000000000046}#2.0#0#C:\WINDOWS\system32\stdole2.tlb#OLE Automation*\CG:\npsveg\archivedparks\apis\Program Files\Microsoft Office\Office\1033\utility.mdax*\C..\Program Files\Microsoft Office\Office\1033\utility.mdac 8*\G{00025E01-0000-0000-C000-000000000046}#5.0#0#C:\Program Files\Common Files\Microsoft Shared\DAO\dao360.dll#Microsoft DAO 3.6 Object Library <%>  MQU^66:>@DMQU^66:@HF:6D84MQU^66:6D8WMQU^66:6D8bMQU^66:6D8iMQU^66:6D8oMQU^66:6D8yMQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:86@MQU^66:86@:MQU^66:86@RMQU^66:86@[MQU^66:86@`MQU^66:86@cMQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66::@D"MQU^66::@D;MQU^66::@DBMQU^66::@DFMQU^66::@DGMQU^66::@DRMQU^66::@DTMQU^66::@DoMQU^66::@DsMQU^66::@D{MQU^66::@D}MQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::F:MQU^66:>8CMQU^66:>><"MQU^66:>><3MQU^66:>><gMQU^66:>><|MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>>>>MQU^66:>>>>MQU^66:>>>SMQU^66:>>>MQU^66:>>>MQU^66:>>>MQU^66:>>@4MQU^66:>>@7MQU^66:>>@wMQU^66:>>D(MQU^66:>>DWMQU^66:>>DMQU^66:>>DMQU^66:>>DMQU^66:>>HMQU^66:>>H$MQU^66:>>H=MQU^66:>>H=MQU^66:>>HDMQU^66:>>HDMQU^66:>>HFMQU^66:>>HKMQU^66:>>HPMQU^66:>>HPMQU^66:>>HQMQU^66:>>HTMQU^66:>>HVMQU^66:>>HVMQU^66:>>HYMQU^66:>>H`MQU^66:>>HdMQU^66:>>HnMQU^66:>>HuMQU^66:>>HwMQU^66:>>HxMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>@BMQU^66:>@B!MQU^66:>@BqMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@DMQU^66:>@D(MQU^66:>@D0MQU^66:>@D6MQU^66:>@D7MQU^66:>@D?MQU^66:>@DBMQU^66:>@DCMQU^66:>@DJMQU^66:>@DMMQU^66:>@DRMQU^66:>@DVMQU^66:>@D]MQU^66:>@D_MQU^66:>@DdMQU^66:>@DkMQU^66:>@DkMQU^66:>@DwMQU^66:>@D{MQU^66:>@DMQU^66:>@D  B @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ bMQU^66:6D84MQU^66:6D8WMQU^66:6D8bMQU^66:6D8iMQU^66:6D8oMQU^66:6D8yMQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:6D8MQU^66:86@MQU^66:86@:MQU^66:86@RMQU^66:86@[MQU^66:86@`MQU^66:86@cMQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66:86@MQU^66::@D"MQU^66::@D;MQU^66::@DBMQU^66::@DFMQU^66::@DGMQU^66::@DRMQU^66::@DTMQU^66::@DoMQU^66::@DsMQU^66::@D{MQU^66::@D}MQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::@DMQU^66::F:MQU^66:>8CMQU^66:>><"MQU^66:>><3MQU^66:>><gMQU^66:>><|MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>><MQU^66:>>>>MQU^66:>>>>MQU^66:>>>SMQU^66:>>>MQU^66:>>>MQU^66:>>>MQU^66:>>@4MQU^66:>>@7MQU^66:>>@wMQU^66:>>D(MQU^66:>>DWMQU^66:>>DMQU^66:>>DMQU^66:>>DMQU^66:>>HMQU^66:>>H$MQU^66:>>H=MQU^66:>>H=MQU^66:>>HDMQU^66:>>HDMQU^66:>>HFMQU^66:>>HKMQU^66:>>HPMQU^66:>>HPMQU^66:>>HQMQU^66:>>HTMQU^66:>>HVMQU^66:>>HVMQU^66:>>HYMQU^66:>>H`MQU^66:>>HdMQU^66:>>HnMQU^66:>>HuMQU^66:>>HwMQU^66:>>HxMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>>HMQU^66:>@BMQU^66:>@B!MQU^66:>@BqMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@BMQU^66:>@DMQU^66:>@D(MQU^66:>@D0MQU^66:>@D6MQU^66:>@D7MQU^66:>@D?MQU^66:>@DBMQU^66:>@DCMQU^66:>@DJMQU^66:>@DMMQU^66:>@DRMQU^66:>@DVMQU^66:>@D]MQU^66:>@D_MQU^66:>@DdMQU^66:>@DkMQU^66:>@DkMQU^66:>@DwMQU^66:>@D{MQU^66:>@DMQU^66:>@D  @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ MQU^66:>@D>@D>@D>@D>@D>@D>@D>@D>@D>@D>@D>@F>@F>B8>B83>B85>B87>B87>B8;>B8L>B8R>B8o>B8>B8>B8>B8>B8>B8>B8>B8>B8>B8>B8>B8>B<!>B<6>B<d>B<x>B<>B<>B<>B<>B<>BB>BB$>BB)>BB2>BB6>BB8>BB:>BBM>BBf>BBf>BBg>BBl>BBq>BBu>BBw>BB|>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BB>BD>BD>BD>BD>BD>BD>BD>BD>BF>BF)>BF4>BFL>BF_>BFi>BFn>BFn>BFq>BFs>BF{>BF|>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>BF>D8'>D8>D8>D8>D8>D8>D>>D>)>D>S>D>^>D>`>D>l>D>u>D>}>D>>D>>D>>D>>D>>D>>D>>D>>D>>D>>D>>D>>D>>DFl>DF>DF>DF>DF>DH>DH>DH>DH >DH'>DH;>DHY>DHk>DH>DH>DH@6<B@6<@6<@6D]@6Do@6Dy@6D@6D@:6S@:6@:6@B:@B:@F>@F>7@F>D@F>F@F>Y@F>`@F>n@F>u@F>@F>@F>@F>@F>@F>@F>@F>@F>@F>@F>@FHN@FHP@FH^@FHg@FH@FH@FH@FH@H6@H6@H6@H6@H6@HF@HF @HF3@HFC@HFK@HFN@HF^@HFk@HFl@HFs@HFt@HFw@HFx@HF@HF@HF@HF@HF@HF@HF@HF@HFMQU^66:>D8MQU^66:>D8MQU^66:>D8MQU^66:>D>MQU^66:>D>)MQU^66:>D>SMQU^66:>D>^MQU^66:>D>`MQU^66:>D>lMQU^66:>D>uMQU^66:>D>}MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>D>MQU^66:>DFlMQU^66:>DFMQU^66:>DFMQU^66:>DFMQU^66:>DFMQU^66:>DHMQU^66:>DHMQU^66:>DHMQU^66:>DH MQU^66:>DH'MQU^66:>DH;MQU^66:>DHYMQU^66:>DHkMQU^66:>DHMQU^66:>DHMQU^66:>DHMQU^66:@6<BMQU^66:@6<MQU^66:@6<MQU^66:@6D]MQU^66:@6DoMQU^66:@6DyMQU^66:@6DMQU^66:@6DMQU^66:@:6SMQU^66:@:6MQU^66:@:6MQU^66:@B:MQU^66:@B:MQU^66:@F>MQU^66:@F>7MQU^66:@F>DMQU^66:@F>FMQU^66:@F>YMQU^66:@F>`MQU^66:@F>nMQU^66:@F>uMQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@F>MQU^66:@FHNMQU^66:@FHPMQU^66:@FH^MQU^66:@FHgMQU^66:@FHMQU^66:@FHMQU^66:@FHMQU^66:@FHMQU^66:@H6MQU^66:@H6MQU^66:@H6MQU^66:@H6MQU^66:@H6MQU^66:@HFMQU^66:@HF MQU^66:@HF3MQU^66:@HFCMQU^66:@HFK< @ @ @ @ @MQU^66>6:>(MQU^66>6:>MQU^66>6:>MQU^66@66<MQU^66@66<}MQU^66@66<MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>!MQU^66@6>>"MQU^66@6>>$MQU^66@6>>(MQU^66@6>>0MQU^66@6>>1MQU^66@6>>8MQU^66@6>>?MQU^66@6>>AMQU^66@6>>AMQU^66@6>>DMQU^66@6>>JMQU^66@6>>LMQU^66@6>>MMQU^66@6>>PMQU^66@6>>SMQU^66@6>>VMQU^66@6>>WMQU^66@6>>`MQU^66@6>>cMQU^66@6>>cMQU^66@6>>cMQU^66@6>>dMQU^66@6>>mMQU^66@6>>tMQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6>>MQU^66@6B>MQU^66@6B>"MQU^66@6B>8MQU^66@6B>KMQU^66@6B>MQU^66@6B>MQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HF0MQU^66@6HF2MQU^66@6HF5MQU^66@6HF6MQU^66@6HF>MQU^66@6HF>MQU^66@6HFFMQU^66@6HFFMQU^66@6HFNMQU^66@6HF_MQU^66@6HFmMQU^66@6HFtMQU^66@6HFtMQU^66@6HFyMQU^66@6HF}MQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@6HFMQU^66@8:@JMQU^66@8:@_MQU^66@8:@|MQU^66@8:@MQU^66@8:@MQU^66@8:@MQU^66@8:@MQU^66@8:@MQU^66@8:@MQU^66@8:@MQU^66@8B@BMQU^66@8B@iMQU^66@8B@MQU^66@8D>6MQU^66@8D>GMQU^66@8D>NMQU^66@8D>QMQU^66@8D>QMQU^66@8D>VMQU^66@8D>^MQU^66@8D>tMQU^66@8D>MQU^66@8D>MQU^66@8D>MQU^66@8D>MQU^66@8D>MQU^66@8D>MQU^66@::DMQU^66@::D3MQU^66@::D5MQU^66@::D=MQU^66@::DMMQU^66@::D[MQU^66@::DmMQU^66@::DuMQU^66@::DMQU^66@::DMQU^66@::DMQU^66@::DMQU^66@::DMQU^66@::DMQU^66@::FMQU^66@::FMQU^66@::F1MQU^66@::F5MQU^66@::FGMQU^66@::FKMQU^66@::F[MQU^66@::FiMQU^66@::FxMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::FMQU^66@::HMQU^66@::HMQU^66@:>@MQU^66@:>@:MQU^66@:>@MQU^66@:>@MQU^66@:>@MQU^66@:>@MQU^66@:D8MQU^66@:D8MQU^66@:D81MQU^66@:D8JMQU^66@:D8WMQU^66@:D8bMQU^66@:D8fMQU^66@:D8yMQU^66@:D8{MQU^66@:D8|MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:D8MQU^66@:DDMQU^66@:DDMQU^66@:DD MQU^66@:DD MQU^66@:DD2MQU^66@:DD8MQU^66@:DD;MQU^66@:DDCMQU^66@:DDbMQU^66@:DDcMQU^66@:DDsMQU^66@:DDMQU^66@:DDMQU^66@:DDMQU^66@:DDMQU^66@:DDMQU^66@:DDMQU^66@:DDWs`Ws`Ws`Ws`Ws`!Ws`'Ws`0Ws`:Ws`>Ws`?Ws`AWs`AWs`BWs`CWs`GWs`QWs`TWs`YWs`]Ws`]Ws`mWs`oWs`qWs`qWs`xWs`yWs`}Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`Ws`]Ws`mWs`oWs`qWs`qWs`x] Y&mswortroN & Y (Y  Y  Y  Y  Y  Y dY  Y  Y   Y   Y   Y  HY  Y   Y  Y   Y  AA Obs Code$AA Species CounterPlant SymbolScientific NameCommon name FamilySpecimen NumberUsed PLANTS SourceStratum SortStratumDiagnosticRange CoverReal CoverOther Measure1Other Measure2 UpdateUsern v CYYL{0EAB7CC9-DCA1-4DD6-BA54-F7FB5E8B3BA4}AA Obs Code  JfYkJJ>6666<66>66@66B66D66F66H68668868:68<68>68@68B68D68F68H6:66:86::6:<6:>6:@6:B6:D6:F6:H6<66<86<:6<<6<>6<@66 6>8 6>: 6>< 6>>!6>@!6>B!6>D!6>F!6>H"6@6"6@8"6@:"6@<$6@>$6@@$6@B$6@D'6@F'6@H'6B6'6B8(6B:(6B<(6B>(6B@(6BB)6BD)6BF)6BH)6D606D806D:06D<06D>16D@16DB16DD16DF26DH26F626F826F:36F<36F>36F@36FB36FD86FF86FH86H686H8:6H::6H<:6H>:6H@;6HB;6HD;6HF;6HH=866=868=86:=86<=86>>86@>86B>86D>86F>86H?886?888?88:?88<A88>A88@A88BA88DB88FB88HB8:6B8:8B8::C8:<C8:>C8:@C8:BC8:DD8:FD8:HD8<6D8<8F8<:F8<<F8<>F8<@F86G8>8J8>:J8><J8>>J8>@K8>BK8>DK8>FK8>HL8@6L8@8L8@:L8@<M8@>M8@@M8@BM8@DM8@FN8@HN8B6N8B8N8B:N8B<P8B>P8B@P8BBP8BDQ8BFQ8BHQ8D6Q8D8R8D:R8D<R8D>R8D@S8DBS8DDS8DFS8DHT8F6T8F8T8F:T8F<V8F>V8F@V8FBV8FDV8FFW8FHW8H6W8H8W8H:Y8H<Y8H>Y8H@Y8HB[8HD[8HF[8HH[:66]:68]:6:]:6<]:6>]:6@^:6B^:6D^:6F^:6H_:86_:88_:8:_:8<`:8>`:8@`:8B`:8D`:8Fb:8Hb::6b::8b:::c::<c::>c::@c::Bc::Dd::Fd::Hd:<6d:<8f:<:f:<<f:<>f:<@g:6i:>8i:>:i:><k:>>k:>@k:>Bk:>Dl:>Fl:>Hl:@6l:@8m:@:m:@<m:@>m:@@m:@Bn:@Dn:@Fn:@Hn:B6n:B8o:B:o:B<o:B>o:B@o:BBq:BDq:BFq:BHq:D6q:D8s:D:s:D<s:D>s:D@s:DBt:DDt:DFt:DHt:F6t:F8u:F:u:F<u:F>u:F@u:FBw:FDw:FFw:FHw:H6w:H8x:H:x:H<x:H>x:H@x:HBy:HDy:HFy:HHy<66y<68{<6:{<6<{<6>{<6@{<6B|<6D|<6F|<6H|<86|<88}<8:}<8<}<8>}<8@}<8B<8D<8F<8H<:6<:8<::<:<<:><:@<:B<:D<:F<:H<<6<<8<<:<<<<<><<@<6<>8<>:<><<>><>@<>B<>D<>F<>H4<@64<@84<@:4<@<<@><@@<@B<@D<@F<@H66 @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @ @JfYkJJ66866:66<66>66@66B66D66F66H68668868:68<68>68@68B68D68F68H6:66:86::6:<6:>6:@6:B6:D6:F6:H6<66<86<:6<<6<>6<@66 6>8 6>: 6>< 6>>!6>@!6>B!6>D!6>F!6>H"6@6"6@8"6@:"6@<$6@>$6@@$6@B$6@D'6@F'6@H'6B6'6B8(6B:(6B<(6B>(6B@(6BB)6BD)6BF)6BH)6D606D806D:06D<06D>16D@16DB16DD16DF26DH26F626F826F:36F<36F>36F@36FB36FD86FF86FH86H686H8:6H::6H<:6H>:6H@;6HB;6HD;6HF;6HH=866=868=86:=86<=86>>86@>86B>86D>86F>86H?886?888?88:?88<A88>A88@A88BA88DB88FB88HB8:6B8:8B8::C8:<C8:>C8:@C8:BC8:DD8:FD8:HD8<6D8<8F8<: